DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and tlr13

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_002935047.2 Gene:tlr13 / 100485164 XenbaseID:XB-GENE-5873547 Length:948 Species:Xenopus tropicalis


Alignment Length:620 Identity:144/620 - (23%)
Similarity:239/620 - (38%) Gaps:192/620 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RNCSLNA-------CESLGIVSQLLMLINSMPNGTQSAANDKKPPKSKANGHNDGDVNGGEINAM 109
            |.|||..       |....:|: |...|..:|..|: ..|..:...||.:|:           ..
 Frog    29 RKCSLEGIHTEYANCVGQSVVT-LADAIQDLPYQTR-VLNISENEISKIDGY-----------TF 80

  Fly   110 SHLANF-DLVKRVRQIESRLRSVEQPVWHLATG---SQIEWNHCTSGVCRCNPDTKSFTCWNTNL 170
            |||... :||.|    ::::..|:...:|....   ..:.:|...|      .||...    |:|
 Frog    81 SHLPKLQELVLR----KNKVNGVDTWAFHNLNDLLILDLSYNLIQS------LDTVDL----TDL 131

  Fly   171 KSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELDIS-HNVLDF---------LP---- 221
            |.:.:          .|||.|.:.|:...|...|..|:|||:| :||.||         ||    
 Frog   132 KHLQI----------FDLSHNRIHTIQMGTLGPLGALQELDLSFNNVSDFRSVANAVSQLPDFLR 186

  Fly   222 --------FDLFQD-----LDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIF 273
                    .||..:     |.||..|.::||.:..:|. ||:.:.:|..|::::|.:..:.:|.|
 Frog   187 LSLSSNFITDLKSEQSVTVLSSLQSLNLRNNSISVLDF-TFYSMPSLIELNVTRNNLSAVNKSSF 250

  Fly   274 YHAQRLTVINMCDNQIQNFP-------PNL-----------LRDQLM-----------LEELDMS 309
            .:...|..:...:|.: |..       |||           |:.:|:           |:.||:.
 Frog   251 SNLPMLAKVTFDENSL-NISQLLGLVLPNLTEFHWSSMRPALQHELVSACQVFQTFPKLQLLDIK 314

  Fly   310 RNKISELSSGSIRYLTKLKTL----------------DFGWNQIAKID--------DDFFAGLRS 350
            .:||:..:...|...|.|.:|                ||.:.::..:|        :..:.||.:
 Frog   315 HSKIAVTNLSIIGRCTNLTSLILSTSPLPRLQEKDLQDFKYLEVLYLDKCKLRRIANSSWRGLNN 379

  Fly   351 LRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVEL------------------- 396
            |.||.|..|::|.|...:|:.|.:|..|||:.|.::|::..||..|                   
 Frog   380 LHTLILERNQLSDLEDKLFSPLTSLQYLDLSKNYLTHLNEKAFSGLRRLNYLSLKGCKITAATRN 444

  Fly   397 -----NNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKIL-LLNNN 455
                 :||..|.|..||:|.|.::..:.:..|..|.|..|.:.|::.:..:||.:||.| |.|||
 Frog   445 NFRYFSNLRVLDLQDNSISLIKSNAHIYLRKLETLLLSGNKILTIQKNGLKGLVSLKELSLANNN 509

  Fly   456 ILKNFDARAFEPLSQLEKLRIDSNKL------------------------------MFLPHGALH 490
            |.|..| ..|:.:..|..|.:..|:|                              :::|.....
 Frog   510 IYKITD-NTFKFVKSLRSLDLSRNQLWPLHKFQSPTPFLNLTQLEYLDASYQAEGNIYIPASLFQ 573

  Fly   491 GLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKL 525
            ||::|..::|..||      :.:......||:|.|
 Frog   574 GLQSLKVLRLQGNP------SAFFRNVSFEFLLNL 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 26/85 (31%)
leucine-rich repeat 187..206 CDD:275380 7/18 (39%)
LRR_RI <201..386 CDD:238064 64/264 (24%)
leucine-rich repeat 207..230 CDD:275380 14/49 (29%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 16/88 (18%)
leucine-rich repeat 255..278 CDD:275380 5/22 (23%)
leucine-rich repeat 279..302 CDD:275380 7/40 (18%)
LRR_8 303..361 CDD:290566 19/81 (23%)
leucine-rich repeat 303..326 CDD:275380 6/22 (27%)
leucine-rich repeat 327..350 CDD:275380 7/46 (15%)
LRR_8 349..407 CDD:290566 22/81 (27%)
LRR_4 350..390 CDD:289563 15/39 (38%)
leucine-rich repeat 351..374 CDD:275380 9/22 (41%)
leucine-rich repeat 375..398 CDD:275380 9/46 (20%)
LRR_8 398..>443 CDD:290566 13/44 (30%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 5/19 (26%)
leucine-rich repeat 471..494 CDD:275380 7/52 (13%)
LRRCT 503..554 CDD:214507 6/23 (26%)
tlr13XP_002935047.2 LRR_RI <29..220 CDD:238064 55/227 (24%)
leucine-rich repeat 62..85 CDD:275380 8/34 (24%)
LRR_8 63..144 CDD:290566 23/116 (20%)
leucine-rich repeat 86..133 CDD:275380 11/60 (18%)
LRR_8 132..192 CDD:290566 19/69 (28%)
leucine-rich repeat 134..157 CDD:275380 7/32 (22%)
leucine-rich repeat 158..208 CDD:275380 14/49 (29%)
LRR_8 186..242 CDD:290566 14/56 (25%)
leucine-rich repeat 209..231 CDD:275380 7/22 (32%)
leucine-rich repeat 232..307 CDD:275380 13/75 (17%)
LRR_RI 253..534 CDD:238064 69/282 (24%)
leucine-rich repeat 308..331 CDD:275380 6/22 (27%)
leucine-rich repeat 332..355 CDD:275380 4/22 (18%)
leucine-rich repeat 356..379 CDD:275380 3/22 (14%)
LRR_8 379..438 CDD:290566 18/58 (31%)
leucine-rich repeat 380..403 CDD:275380 9/22 (41%)
leucine-rich repeat 404..427 CDD:275380 9/22 (41%)
leucine-rich repeat 428..451 CDD:275380 0/22 (0%)
leucine-rich repeat 452..475 CDD:275380 7/22 (32%)
LRR_8 474..534 CDD:290566 21/60 (35%)
leucine-rich repeat 476..499 CDD:275380 7/22 (32%)
LRR_8 499..587 CDD:290566 20/88 (23%)
leucine-rich repeat 500..523 CDD:275380 11/23 (48%)
leucine-rich repeat 524..577 CDD:275380 7/52 (13%)
leucine-rich repeat 578..631 CDD:275380 8/31 (26%)
LRR_8 631..685 CDD:290566
leucine-rich repeat 632..655 CDD:275380
leucine-rich repeat 656..676 CDD:275380
TIR 792..935 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.