DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and lrrc4c

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_002938986.1 Gene:lrrc4c / 100188921 XenbaseID:XB-GENE-5772259 Length:639 Species:Xenopus tropicalis


Alignment Length:470 Identity:120/470 - (25%)
Similarity:179/470 - (38%) Gaps:147/470 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 CTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGL-TVLKELDI 212
            |.| ||.|:.......|...||:.||                           .|: |..::|::
 Frog    47 CPS-VCSCSNQFSKVICTRRNLREVP---------------------------DGISTNTRQLNL 83

  Fly   213 SHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQ 277
            ..|.:..:..|.|:.|..|.||::..|.:..|:...|..|.|||.|:|..|              
 Frog    84 HENQIQIIKVDSFKHLRHLEVLQLSRNHIRTIEIGAFNGLANLNTLELFDN-------------- 134

  Fly   278 RLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDD 342
            |||.|           ||                       |:..||:|||.|   |        
 Frog   135 RLTTI-----------PN-----------------------GAFEYLSKLKEL---W-------- 154

  Fly   343 DFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDL-TTNRISHIDGNAFVELNNLNELFLGQ 406
                         |.||.|.|:....||.:.:|..||| ...|:|:|...||..|:||..|.||.
 Frog   155 -------------LRNNPIESIPSYAFNRIPSLRRLDLGEMKRLSYISEGAFEGLSNLKYLNLGM 206

  Fly   407 NSMSSIPADLFLNVSALTR---LTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPL 468
            .::..||     |::.|.:   |.|..|:|:.|....||||.:|:.|.:.::.::..:..||:.|
 Frog   207 CNLRDIP-----NLTPLVKLDELDLSGNHLSVLRPGSFQGLTHLQKLWIMHSQIQVIERNAFDDL 266

  Fly   469 SQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQ--P 531
            ..|.:|.:..|.|..|||.....|.||..::|..|||:|:|..|:|:.|::|.|.   .|..  .
 Frog   267 QSLVELNLAHNNLTLLPHDLFTPLHNLQRIQLHHNPWNCNCDILWLSWWLKEIVT---TGSTCCA 328

  Fly   532 MCRGPGDLGGHEVGLLRYD----------------DLCDGQWASMLSLSPRLPVRKHQISTPMNY 580
            .|..|..|.|..:..|.::                ::.:|..|.:          |.:.||.:.|
 Frog   329 RCSTPPSLKGTHIAELDHNYFTCYAPVIVEPPADLNVTEGMAAEL----------KCRASTSLTY 383

  Fly   581 TDYFNLYLKHIYNGT 595
            ..:..      .|||
 Frog   384 VSWIT------PNGT 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 11/59 (19%)
leucine-rich repeat 187..206 CDD:275380 1/19 (5%)
LRR_RI <201..386 CDD:238064 46/186 (25%)
leucine-rich repeat 207..230 CDD:275380 5/22 (23%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 12/59 (20%)
leucine-rich repeat 255..278 CDD:275380 5/22 (23%)
leucine-rich repeat 279..302 CDD:275380 5/22 (23%)
LRR_8 303..361 CDD:290566 11/57 (19%)
leucine-rich repeat 303..326 CDD:275380 3/22 (14%)
leucine-rich repeat 327..350 CDD:275380 4/22 (18%)
LRR_8 349..407 CDD:290566 22/58 (38%)
LRR_4 350..390 CDD:289563 14/40 (35%)
leucine-rich repeat 351..374 CDD:275380 7/22 (32%)
leucine-rich repeat 375..398 CDD:275380 10/23 (43%)
LRR_8 398..>443 CDD:290566 15/47 (32%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 7/22 (32%)
leucine-rich repeat 471..494 CDD:275380 8/22 (36%)
LRRCT 503..554 CDD:214507 16/68 (24%)
lrrc4cXP_002938986.1 LRRNT 47..78 CDD:214470 12/58 (21%)
LRR <77..302 CDD:227223 83/301 (28%)
leucine-rich repeat 78..101 CDD:275380 5/22 (23%)
leucine-rich repeat 102..125 CDD:275380 7/22 (32%)
leucine-rich repeat 126..149 CDD:275380 14/70 (20%)
leucine-rich repeat 150..173 CDD:275380 11/46 (24%)
leucine-rich repeat 174..198 CDD:275380 10/23 (43%)
leucine-rich repeat 199..220 CDD:275380 8/25 (32%)
leucine-rich repeat 221..244 CDD:275380 9/22 (41%)
leucine-rich repeat 245..268 CDD:275380 5/22 (23%)
leucine-rich repeat 269..290 CDD:275380 7/20 (35%)
LRRCT 301..351 CDD:214507 16/52 (31%)
Ig 354..443 CDD:416386 9/55 (16%)
Ig strand A 354..357 CDD:409353 0/2 (0%)
Ig strand A' 361..364 CDD:409353 0/2 (0%)
Ig strand B 370..377 CDD:409353 2/16 (13%)
Ig strand C 383..388 CDD:409353 1/4 (25%)
Ig strand C' 391..393 CDD:409353 2/2 (100%)
Ig strand D 402..406 CDD:409353
Ig strand E 409..413 CDD:409353
Ig strand F 423..430 CDD:409353
Ig strand G 433..443 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.