Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002933279.1 | Gene: | slitrk3 / 100127669 | XenbaseID: | XB-GENE-964617 | Length: | 885 | Species: | Xenopus tropicalis |
Alignment Length: | 530 | Identity: | 124/530 - (23%) |
---|---|---|---|
Similarity: | 196/530 - (36%) | Gaps: | 148/530 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 182 NMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDH 246
Fly 247 RTFWKLRNLNILDLSKNEIGMLPESIF---------YHAQRLTVI---NMCD------------- 286
Fly 287 -------------NQIQNFPPNLLRDQLMLEE---------LDMSRNKI---------------- 313
Fly 314 --------------------SELSSGSIRYLTKLKT------------------LDFGWNQ--IA 338
Fly 339 --------------------KIDDDFFAGLR-------------------SLRTLSLHNNRISSL 364
Fly 365 SGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLF 429
Fly 430 SNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLP-HGALHGLK 493
Fly 494 NLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLGGHEVGLLRYDDLCDGQWA 558
Fly 559 SMLSLSPRLP 568 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | 22/58 (38%) |
leucine-rich repeat | 187..206 | CDD:275380 | 5/18 (28%) | ||
LRR_RI | <201..386 | CDD:238064 | 64/326 (20%) | ||
leucine-rich repeat | 207..230 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 231..254 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 253..313 | CDD:290566 | 18/106 (17%) | ||
leucine-rich repeat | 255..278 | CDD:275380 | 8/31 (26%) | ||
leucine-rich repeat | 279..302 | CDD:275380 | 6/51 (12%) | ||
LRR_8 | 303..361 | CDD:290566 | 21/161 (13%) | ||
leucine-rich repeat | 303..326 | CDD:275380 | 7/67 (10%) | ||
leucine-rich repeat | 327..350 | CDD:275380 | 11/81 (14%) | ||
LRR_8 | 349..407 | CDD:290566 | 21/76 (28%) | ||
LRR_4 | 350..390 | CDD:289563 | 13/39 (33%) | ||
leucine-rich repeat | 351..374 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 375..398 | CDD:275380 | 11/22 (50%) | ||
LRR_8 | 398..>443 | CDD:290566 | 10/44 (23%) | ||
leucine-rich repeat | 399..422 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 423..443 | CDD:275380 | 4/19 (21%) | ||
leucine-rich repeat | 471..494 | CDD:275380 | 8/23 (35%) | ||
LRRCT | 503..554 | CDD:214507 | 13/50 (26%) | ||
slitrk3 | XP_002933279.1 | LRR_8 | 81..137 | CDD:338972 | 13/34 (38%) |
leucine-rich repeat | 81..102 | CDD:275380 | 124/530 (23%) | ||
leucine-rich repeat | 103..126 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 127..185 | CDD:338972 | 20/57 (35%) | ||
leucine-rich repeat | 127..150 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 151..174 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 175..197 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 198..283 | CDD:275380 | 11/84 (13%) | ||
leucine-rich repeat | 224..236 | CDD:275378 | 0/11 (0%) | ||
LRRCT | 232..>270 | CDD:214507 | 4/37 (11%) | ||
LRR | <388..>562 | CDD:227223 | 48/174 (28%) | ||
leucine-rich repeat | 389..409 | CDD:275380 | 0/19 (0%) | ||
leucine-rich repeat | 410..433 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 434..457 | CDD:275380 | 11/22 (50%) | ||
LRR_8 | 457..516 | CDD:338972 | 17/58 (29%) | ||
leucine-rich repeat | 458..481 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 482..505 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 506..528 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 529..553 | CDD:275380 | 8/23 (35%) | ||
LRRCT | 562..>597 | CDD:214507 | 11/35 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |