DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and lingo1

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001093719.1 Gene:lingo1 / 100101739 XenbaseID:XB-GENE-921957 Length:606 Species:Xenopus tropicalis


Alignment Length:416 Identity:114/416 - (27%)
Similarity:187/416 - (44%) Gaps:40/416 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PVWHLATGSQIEWNHCTSGV---CRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILST 195
            |:..:..||.:..:  .||.   |.|:|..:|..|.......||  :.||.:...:|||:|.:..
 Frog    11 PILLIVVGSILSGS--ASGCPQRCDCSPQDRSVLCHRKRYLDVP--EGIPTDTRLLDLSKNRIKA 71

  Fly   196 LHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDL 260
            |::|.|.....|:||:::.|::..:....|..|.:|..|.:::|:|:.|....|..|.||..||:
 Frog    72 LNQDEFSAFPYLEELELNENIVSIIEPGAFNGLFNLRSLGLRSNRLKLIPLGVFTGLSNLTQLDI 136

  Fly   261 SKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLT 325
            |:|:|.:|.:.:|.....|..:.:.||.:........|....||||.:.:..::.:.:.::.:|.
 Frog   137 SENKIVILLDDMFQDLYNLKSLEVGDNDLVYISHRAFRGLNSLEELTLEKCNLTSVPTEALSHLH 201

  Fly   326 KLKTLDFGWNQIAKIDDDFFAGLRSLRTLSL-HNNRISSLSGTIFNNLANLVTLDLTTNRISHID 389
            .|.||...:..|..|.|..|..|..|:.|.: |...:.:::......| ||.:|.:|.:.:|.|.
 Frog   202 GLITLKLRYLNINVIRDYSFKRLYRLKNLEIAHWPYLDTMTSNGLYGL-NLTSLSITHSNLSSIP 265

  Fly   390 GNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNN 454
            ..|...|..|..|.|..|.::::...:...:..|....|....|:.:|...|:|||:||:     
 Frog   266 YVAIRHLVYLRFLNLSYNPITAVEGSMLYELLRLQEFHLVGGQLSVVEPYAFRGLNHLKV----- 325

  Fly   455 NILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYL--ARW 517
                               |.:.||.|..|...:.|.:.||..:.|||||..||||.|::  .||
 Frog   326 -------------------LNVSSNYLSTLEESSFHSVGNLETLILDKNPLACDCRLLWIFRRRW 371

  Fly   518 IREFVLKLWDGQQPMCRGPGDLGGHE 543
            ...|     ..|||.|..|..:.|.|
 Frog   372 RLNF-----SRQQPSCSSPEYVQGKE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 16/58 (28%)
leucine-rich repeat 187..206 CDD:275380 7/18 (39%)
LRR_RI <201..386 CDD:238064 48/185 (26%)
leucine-rich repeat 207..230 CDD:275380 6/22 (27%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 17/59 (29%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 4/22 (18%)
LRR_8 303..361 CDD:290566 16/58 (28%)
leucine-rich repeat 303..326 CDD:275380 5/22 (23%)
leucine-rich repeat 327..350 CDD:275380 8/22 (36%)
LRR_8 349..407 CDD:290566 15/58 (26%)
LRR_4 350..390 CDD:289563 10/40 (25%)
leucine-rich repeat 351..374 CDD:275380 4/23 (17%)
leucine-rich repeat 375..398 CDD:275380 7/22 (32%)
LRR_8 398..>443 CDD:290566 9/44 (20%)
leucine-rich repeat 399..422 CDD:275380 4/22 (18%)
leucine-rich repeat 423..443 CDD:275380 5/19 (26%)
leucine-rich repeat 471..494 CDD:275380 6/22 (27%)
LRRCT 503..554 CDD:214507 17/43 (40%)
lingo1NP_001093719.1 LRRNT 27..61 CDD:214470 10/35 (29%)
LRR 1 58..79 7/20 (35%)
leucine-rich repeat 59..82 CDD:275380 7/22 (32%)
PLN00113 62..>381 CDD:215061 95/348 (27%)
LRR 2 82..103 5/20 (25%)
leucine-rich repeat 83..106 CDD:275380 6/22 (27%)
LRR_8 106..165 CDD:338972 19/58 (33%)
LRR 3 106..127 6/20 (30%)
leucine-rich repeat 107..130 CDD:275380 7/22 (32%)
LRR 4 130..151 9/20 (45%)
leucine-rich repeat 131..154 CDD:275380 8/22 (36%)
LRR 5 154..175 3/20 (15%)
leucine-rich repeat 155..178 CDD:275380 4/22 (18%)
LRR 6 178..199 4/20 (20%)
leucine-rich repeat 179..250 CDD:275380 17/71 (24%)
LRR 7 202..223 7/20 (35%)
leucine-rich repeat 203..226 CDD:275380 8/22 (36%)
LRR 8 250..271 7/20 (35%)
leucine-rich repeat 251..274 CDD:275380 7/22 (32%)
LRR 9 274..295 4/20 (20%)
leucine-rich repeat 275..298 CDD:275380 4/22 (18%)
LRR 10 298..319 5/20 (25%)
leucine-rich repeat 299..322 CDD:275380 7/22 (32%)
LRR 11 322..343 7/44 (16%)
leucine-rich repeat 323..343 CDD:275380 7/43 (16%)
Ig 425..500 CDD:386229
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.