Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093704.1 | Gene: | dcn / 100101716 | XenbaseID: | XB-GENE-485545 | Length: | 364 | Species: | Xenopus tropicalis |
Alignment Length: | 248 | Identity: | 70/248 - (28%) |
---|---|---|---|
Similarity: | 114/248 - (45%) | Gaps: | 30/248 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 279 LTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDD 343
Fly 344 FFAGL---------------------RSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRI-- 385
Fly 386 SHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKIL 450
Fly 451 LLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKN 503 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
leucine-rich repeat | 187..206 | CDD:275380 | |||
LRR_RI | <201..386 | CDD:238064 | 35/129 (27%) | ||
leucine-rich repeat | 207..230 | CDD:275380 | |||
leucine-rich repeat | 231..254 | CDD:275380 | |||
LRR_8 | 253..313 | CDD:290566 | 8/33 (24%) | ||
leucine-rich repeat | 255..278 | CDD:275380 | |||
leucine-rich repeat | 279..302 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 303..361 | CDD:290566 | 21/78 (27%) | ||
leucine-rich repeat | 303..326 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 327..350 | CDD:275380 | 8/43 (19%) | ||
LRR_8 | 349..407 | CDD:290566 | 19/59 (32%) | ||
LRR_4 | 350..390 | CDD:289563 | 15/41 (37%) | ||
leucine-rich repeat | 351..374 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 375..398 | CDD:275380 | 7/24 (29%) | ||
LRR_8 | 398..>443 | CDD:290566 | 12/44 (27%) | ||
leucine-rich repeat | 399..422 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 423..443 | CDD:275380 | 6/19 (32%) | ||
leucine-rich repeat | 471..494 | CDD:275380 | 8/22 (36%) | ||
LRRCT | 503..554 | CDD:214507 | 1/1 (100%) | ||
dcn | NP_001093704.1 | LRRNT | 58..90 | CDD:214470 | 5/22 (23%) |
leucine-rich repeat | 67..87 | CDD:275380 | 4/19 (21%) | ||
PRK15370 | <75..>303 | CDD:185268 | 64/234 (27%) | ||
leucine-rich repeat | 88..111 | CDD:275380 | 8/25 (32%) | ||
leucine-rich repeat | 112..135 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 136..156 | CDD:275380 | 0/19 (0%) | ||
leucine-rich repeat | 157..180 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 181..206 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 207..227 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 228..251 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 252..275 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 299..320 | CDD:275380 | 3/9 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |