DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13711 and CG13713

DIOPT Version :10

Sequence 1:NP_647928.1 Gene:CG13711 / 38576 FlyBaseID:FBgn0035572 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_652709.1 Gene:CG13713 / 59233 FlyBaseID:FBgn0042199 Length:99 Species:Drosophila melanogaster


Alignment Length:80 Identity:37/80 - (46%)
Similarity:56/80 - (70%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QQQPKGTPNVGYHLYLYRQQLSQKNVEYMRLSKAKYFITDTLLAKTVRNLKGYSADELKTVNHQI 94
            :|:....|.|.|||:|||.:|:::|...:|||:.|..|||.|::.||||||..|.|:||.||.::
  Fly     2 EQEKMLKPTVTYHLFLYRVELARRNARQLRLSRTKIEITDELISNTVRNLKTCSLDDLKAVNREL 66

  Fly    95 VFRHKLRRQIQRLRK 109
            :|:.|||..:.:|:|
  Fly    67 LFKRKLRSNVSKLKK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13711NP_647928.1 DUF733 36..120 CDD:428418 36/74 (49%)
CG13713NP_652709.1 DUF733 8..92 CDD:428418 36/74 (49%)

Return to query results.
Submit another query.