DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13711 and SNCF

DIOPT Version :9

Sequence 1:NP_647928.1 Gene:CG13711 / 38576 FlyBaseID:FBgn0035572 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_648635.1 Gene:SNCF / 39496 FlyBaseID:FBgn0036349 Length:146 Species:Drosophila melanogaster


Alignment Length:88 Identity:33/88 - (37%)
Similarity:56/88 - (63%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QQPKGTPNVGYHLYLYRQQLSQKNVE--YMRLSKAKYFITDTLLAKTVRNLK-GYSADELKTVNH 92
            ::...|.|..|.|:||||:|.:.:.:  |:||||||..:|..|:||.:.:.. ..|.||||.::.
  Fly    47 RRKSATVNFPYQLFLYRQELRRASADFSYLRLSKAKIVLTSQLIAKKMGSCNPDCSVDELKELSR 111

  Fly    93 QIVFRHKLRRQIQRLRKLRSLGI 115
            ::.|:.:|..|::||::.|.||:
  Fly   112 EVQFQKRLCHQVERLQQFRQLGL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13711NP_647928.1 DUF733 36..120 CDD:283068 33/83 (40%)
SNCFNP_648635.1 DUF733 52..138 CDD:283068 33/83 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006720
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.