DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13711 and halo

DIOPT Version :10

Sequence 1:NP_647928.1 Gene:CG13711 / 38576 FlyBaseID:FBgn0035572 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001137765.1 Gene:halo / 33334 FlyBaseID:FBgn0001174 Length:109 Species:Drosophila melanogaster


Alignment Length:79 Identity:26/79 - (32%)
Similarity:55/79 - (69%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PNVGYHLYLYRQQLSQKNVEYMRLSKAKYFITDTLLAKTVRNLKGYSADELKTVNHQIVFRHKLR 101
            |::.|.|:.||::|.:::..:|::|..|..:||.|:.:|::|::.|...|:..:|.:|.|:.:|.
  Fly    17 PSLHYTLFAYREELRRRDAPFMKMSTIKLHLTDNLILQTIKNIRQYDTIEIMNLNQEINFKRRLT 81

  Fly   102 RQIQRLRKLRSLGI 115
            :|::::|||..||:
  Fly    82 KQMRKVRKLEKLGL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13711NP_647928.1 DUF733 36..120 CDD:428418 26/79 (33%)
haloNP_001137765.1 DUF733 17..100 CDD:428418 26/79 (33%)

Return to query results.
Submit another query.