| Sequence 1: | NP_647927.3 | Gene: | CG12493 / 38575 | FlyBaseID: | FBgn0035571 | Length: | 296 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_609676.1 | Gene: | Adat1 / 34787 | FlyBaseID: | FBgn0028658 | Length: | 394 | Species: | Drosophila melanogaster |
| Alignment Length: | 50 | Identity: | 12/50 - (24%) |
|---|---|---|---|
| Similarity: | 21/50 - (42%) | Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 DGESSLVITDGDSMSKIPDDAAMATSDPKKKKKKVKKLKRSQKAKDRLVR 86 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12493 | NP_647927.3 | DSRM_SF | 95..155 | CDD:444671 | |
| DSRM_SF | 227..284 | CDD:444671 | |||
| Adat1 | NP_609676.1 | ADEAMc | 7..389 | CDD:214718 | 11/49 (22%) |
| Blue background indicates that the domain is not in the aligned region. | |||||