DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12493 and Adar

DIOPT Version :10

Sequence 1:NP_647927.3 Gene:CG12493 / 38575 FlyBaseID:FBgn0035571 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_061519333.1 Gene:Adar / 1272079 VectorBaseID:AGAMI1_003223 Length:1472 Species:Anopheles gambiae


Alignment Length:164 Identity:42/164 - (25%)
Similarity:76/164 - (46%) Gaps:33/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 AAMATSDPKKK--KKKV--------------KKLKRSQKAKDRLVRPLPKAVTSKDALMVLKELK 105
            :||..|.|.::  |:|:              :||:.|.||.:..:..:|:   :|:.:.||.|||
Mosquito    35 SAMLLSTPPRRGTKRKIASVANGNSPAIRKRRKLQHSSKAGESRLEQVPQ---TKNTVAVLNELK 96

  Fly   106 GVIIDNMQIKQD--HEGKNVANIVVNSKKYDAEGSSENSAGNAACEKALREILTTKMKALLA--E 166
            ..::..::.:..  |......::||:.:|:...|.|:..|..||...|||..:..|..|.|.  |
Mosquito    97 RNLVYKVESQTGPVHAPIFTISVVVDGQKFVGTGPSKKLARVAAAASALRSFIQFKDGATLTPIE 161

  Fly   167 P-ENSSGGDEDNILEKMTSYAVYKLAEKWNSDAI 199
            | :|.....:|.::|.    :::.|     |||:
Mosquito   162 PLQNVDFTSDDPMIEN----SIFPL-----SDAV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12493NP_647927.3 DSRM_SF 95..155 CDD:444671 18/61 (30%)
DSRM_SF 227..284 CDD:444671
AdarXP_061519333.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.