DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13712 and CG13713

DIOPT Version :10

Sequence 1:NP_647926.1 Gene:CG13712 / 38574 FlyBaseID:FBgn0035570 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_652709.1 Gene:CG13713 / 59233 FlyBaseID:FBgn0042199 Length:99 Species:Drosophila melanogaster


Alignment Length:110 Identity:20/110 - (18%)
Similarity:41/110 - (37%) Gaps:34/110 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LSVTVFSTSISKKEEALNLLGAENFVISSDHDQMKALEKSLDFLVDTASGDHAFDPYMSLLKIAG 270
            |..|....|::|:..|:.||  .|:....|:..::.|               :|:.:.||..:..
  Fly    43 LPSTSIRESVAKQVHAVVLL--YNYYHRKDNPHLECL---------------SFESFRSLATVMK 90

  Fly   271 TYVLVGFPSEIKISPANLNLGMRMLAGSVTGGTKITQQML-DFCA 314
            ..:|.....:                |.|:|.|.:.:::: |.|:
  Fly    91 PALLQHLKED----------------GGVSGQTVLLEKVIVDACS 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13712NP_647926.1 DUF733 20..109 CDD:428418
CG13713NP_652709.1 DUF733 8..92 CDD:428418 13/65 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.