DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13712 and CG34266

DIOPT Version :9

Sequence 1:NP_647926.1 Gene:CG13712 / 38574 FlyBaseID:FBgn0035570 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001097507.1 Gene:CG34266 / 5740465 FlyBaseID:FBgn0085295 Length:88 Species:Drosophila melanogaster


Alignment Length:99 Identity:35/99 - (35%)
Similarity:55/99 - (55%) Gaps:18/99 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EQSVSYALYLHRRELGRPRRKMMRIASTKLQLTNELIQLQQRRQWESAFELEFDAEASSQQMSAL 82
            |.||:|||:|||:||.|.:...::::.||:.||.|||..|::|.          |..|.:.:..|
  Fly     2 EASVAYALFLHRQELRRRQMLYVKVSKTKILLTKELIAEQRQRL----------ANCSPEDLQIL 56

  Fly    83 DREREYRDRLRTNMQRQLEKQQKRKRKYLEEIGK 116
            :||        |..:|||:::.|.:.|.|:.|.|
  Fly    57 NRE--------TQFKRQLQQKLKHRSKQLKAIAK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13712NP_647926.1 DUF733 20..109 CDD:283068 30/88 (34%)
CG34266NP_001097507.1 DUF733 2..86 CDD:283068 35/99 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006720
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.