DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15876 and CG13711

DIOPT Version :9

Sequence 1:NP_647925.1 Gene:CG15876 / 38573 FlyBaseID:FBgn0035569 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_647928.1 Gene:CG13711 / 38576 FlyBaseID:FBgn0035572 Length:127 Species:Drosophila melanogaster


Alignment Length:97 Identity:29/97 - (29%)
Similarity:61/97 - (62%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EAQRNNANHRRGARPSVGYLLFQYQSELTRRHAEPTRLSRTKIHIIDGLVSRTIRHMKHCSMEDL 66
            |.|::....:....|:|||.|:.|:.:|::::.|..|||:.|..|.|.|:::|:|::|..|.::|
  Fly    23 EQQQHCYQQQPKGTPNVGYHLYLYRQQLSQKNVEYMRLSKAKYFITDTLLAKTVRNLKGYSADEL 87

  Fly    67 RACKRELVYKEQLRDQLKNMRRKRSSSVNKVD 98
            :....::|::.:||.|::.:|:.||..:...:
  Fly    88 KTVNHQIVFRHKLRRQIQRLRKLRSLGIKNAN 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15876NP_647925.1 DUF733 15..96 CDD:283068 27/80 (34%)
CG13711NP_647928.1 DUF733 36..120 CDD:283068 27/84 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006720
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.