DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Slc25a27

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_006244672.1 Gene:Slc25a27 / 85262 RGDID:620787 Length:365 Species:Rattus norvegicus


Alignment Length:284 Identity:80/284 - (28%)
Similarity:143/284 - (50%) Gaps:18/284 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PTHMKFVMGGTSGMLATCIVQPLDLLKTRMQI----------SGTLGTREYKNSFEVLSKVLKNE 67
            |...||::.|.:..:|.....||||.|||:|:          .|.:.:..|:........:::.|
  Rat    17 PRTSKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALAKLGDGAMESAPYRGMMRTALGIVQEE 81

  Fly    68 GILSLYNGLSAGLLRQATYTSAKMGVYQ--MELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGN 130
            |.|.|:.|::..:.|...|:..:|..|:  .|:.:.:....:|| :..|:..|::||..|....|
  Rat    82 GFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYP-LWKSVIGGMMAGVIGQFLAN 145

  Fly   131 PAEVALIRM-MSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASY 194
            |.::..::| |...|.:......::.|..||.:|:.:.|:..||.|.:|.:.||.:|||..|.:|
  Rat   146 PTDLVKVQMQMEGKRRLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTY 210

  Fly   195 SLMKNQ--LHGYLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRI-QQMKVIDGKP-EYSGTIDV 255
            ..:|:.  |:..|.:.|..|..::|.|||:.|:...|.|:.|:|| .|.:...|:. .|..:.|.
  Rat   211 DTVKHYLVLNTALEDNIATHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDC 275

  Fly   256 LKKVLKNEGAFAVWKGFTPYLMRM 279
            :.:.::.||..:::|||.|..:||
  Rat   276 VIQAVQGEGFLSLYKGFLPSWLRM 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 25/106 (24%)
PTZ00169 18..296 CDD:240302 78/279 (28%)
Mito_carr 109..205 CDD:278578 29/98 (30%)
Mito_carr 208..300 CDD:278578 24/74 (32%)
Slc25a27XP_006244672.1 Mito_carr 20..119 CDD:278578 24/98 (24%)
Mito_carr 122..218 CDD:278578 29/96 (30%)
Mito_carr 224..311 CDD:278578 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.