DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and DIC1

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_013452.1 Gene:DIC1 / 851063 SGDID:S000004340 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:304 Identity:98/304 - (32%)
Similarity:160/304 - (52%) Gaps:38/304 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KKTVPTHMKFV--MGGTSGMLATCIVQPLDLLKTRMQIS----GTLGTREYKNSFEVLSKVLKNE 67
            |::...::|:.  .||.:|:.||.:..||||.|.|:|.:    .||        |.:|..:|.||
Yeast     6 KESAGKNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTL--------FRMLESILANE 62

  Fly    68 GILSLYNGLSAGLLRQATYTSAKMGVYQMELDWYRKNF---GNYPSMVASMTMGIVAGAFGAMCG 129
            |::.||:||||.:|||.|||:.:.|.|    |..::|.   ....:|...:...:.:||.|.:.|
Yeast    63 GVVGLYSGLSAAVLRQCTYTTVRFGAY----DLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAG 123

  Fly   130 NPAEVALIRMMSDNRLMPEDRRNYKNVGDAFVRIVKDE-GVVALWRGCLPTVGRAMVVNMVQLAS 193
            |.|:|..|||.:|:.|....||||||..|...:|.:.| |:..|:.|..|.:.|.:::...|:.:
Yeast   124 NFADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVT 188

  Fly   194 YSLMKNQLHGYLSEGIPL-------HLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSG 251
            |.:.||    ||...:..       ||||:|::||:.:....|.|:.||||     ::|..::..
Yeast   189 YDVFKN----YLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRI-----MNGSGDHQP 244

  Fly   252 TIDVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNK 295
            .:.:|...::.||...:::|:.|...|:||.|:..|..:||:.|
Yeast   245 ALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 37/106 (35%)
PTZ00169 18..296 CDD:240302 96/295 (33%)
Mito_carr 109..205 CDD:278578 31/96 (32%)
Mito_carr 208..300 CDD:278578 27/95 (28%)
DIC1NP_013452.1 Mito_carr 20..94 CDD:395101 35/85 (41%)
Mito_carr 100..200 CDD:395101 33/103 (32%)
Mito_carr 203..289 CDD:395101 27/91 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.