DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and UCP3

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_172866.1 Gene:UCP3 / 837973 AraportID:AT1G14140 Length:305 Species:Arabidopsis thaliana


Alignment Length:306 Identity:97/306 - (31%)
Similarity:156/306 - (50%) Gaps:18/306 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KTVPTHMKFVMGGTSGMLATCIVQPLDLLKTRMQI--SGTLGTREYKNSFEVLSKVLKNEGILSL 72
            :..||..:.::...|.|:|..:..|:||.|||||:  ||:........:|.|:|::.:.||::.|
plant     8 REAPTGTRILLASLSAMVAESVTFPIDLTKTRMQLHGSGSASGAHRIGAFGVVSEIARKEGVIGL 72

  Fly    73 YNGLSAGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMC---GNPAEV 134
            |.|||..::|...||..::..|:.......::..|....:...|..:|.|..|.:.   .:||::
plant    73 YKGLSPAIIRHLFYTPIRIIGYENLKGLIVRSETNNSESLPLATKALVGGFSGVIAQVVASPADL 137

  Fly   135 ALIRMMSDNRLMPED-RRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMK 198
            ..:||.:|.||:.:. :..|....:||.:|::.|||..||:|.||.:.||.:|||.:||.|...|
plant   138 VKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLPNIQRAFLVNMGELACYDHAK 202

  Fly   199 NQL--HGYLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLK 261
            :.:  .....:.|..|..|:::|||.::..|.|.|:.|||:...   .....|..:.|.|.|.:|
plant   203 HFVIDKKIAEDNIFAHTLASIMSGLASTSLSCPADVVKTRMMNQ---GENAVYRNSYDCLVKTVK 264

  Fly   262 NEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNKAYSKHMLSDSLS 307
            .||..|:||||.|...|:||   :.|||.    .:|.|..|...:|
plant   265 FEGIRALWKGFFPTWARLGP---WQFVFW----VSYEKFRLLAGIS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 29/99 (29%)
PTZ00169 18..296 CDD:240302 91/285 (32%)
Mito_carr 109..205 CDD:278578 32/101 (32%)
Mito_carr 208..300 CDD:278578 32/91 (35%)
UCP3NP_172866.1 Mito_carr 9..104 CDD:395101 29/94 (31%)
Mito_carr 110..209 CDD:395101 32/98 (33%)
Mito_carr 212..299 CDD:395101 33/96 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.