DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and DIC3

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_196509.1 Gene:DIC3 / 830806 AraportID:AT5G09470 Length:337 Species:Arabidopsis thaliana


Alignment Length:329 Identity:113/329 - (34%)
Similarity:170/329 - (51%) Gaps:59/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FVMGGTSGMLATCIVQPLDLLKTRMQISG------------------------------------ 46
            |:.||.:.::|..:..||||:|.|||:.|                                    
plant     6 FLEGGIAAIIAGALTHPLDLIKVRMQLQGEHSFSLDQNPNPNLSLDHNLPVKPYRPVFALDSLIG 70

  Fly    47 ------------TLGTREYKNSFEVLSKVLKNEGILSLYNGLSAGLLRQATYTSAKMGVYQ-MEL 98
                        :..||.....|.|.:.::|.||..:|::|:||.:|||..|::.:||:|. ::.
plant    71 SISLLPLHIHAPSSSTRSVMTPFAVGAHIVKTEGPAALFSGVSATILRQMLYSATRMGIYDFLKR 135

  Fly    99 DWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDNRLMPEDRRNYKNVGDAFVRI 163
            .|..:..||:| :|..:|.|::|||.|::.||||:||::||.:|..|....|||||:|.||..||
plant   136 RWTDQLTGNFP-LVTKITAGLIAGAVGSVVGNPADVAMVRMQADGSLPLNRRRNYKSVVDAIDRI 199

  Fly   164 VKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQL----HGYLSEGIPLHLTAALVSGLLTS 224
            .:.|||.:||||...||.|||:|...|||:|..:|..|    .| ...||..|:.|:..:|::.:
plant   200 ARQEGVSSLWRGSWLTVNRAMIVTASQLATYDHVKEILVAGGRG-TPGGIGTHVAASFAAGIVAA 263

  Fly   225 VTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVF 289
            |.|.|:|:.|||:...    .|..|.|.:|...|::..||..|::||..|...|.||.|:..|:.
plant   264 VASNPIDVVKTRMMNA----DKEIYGGPLDCAVKMVAEEGPMALYKGLVPTATRQGPFTMILFLT 324

  Fly   290 LEQM 293
            |||:
plant   325 LEQV 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 33/138 (24%)
PTZ00169 18..296 CDD:240302 113/329 (34%)
Mito_carr 109..205 CDD:278578 48/99 (48%)
Mito_carr 208..300 CDD:278578 31/86 (36%)
DIC3NP_196509.1 Mito_carr <19..139 CDD:395101 28/119 (24%)
Mito_carr 143..238 CDD:395101 48/95 (51%)
Mito_carr 251..336 CDD:395101 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2939
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2168
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.