DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and AT4G15010

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_567453.1 Gene:AT4G15010 / 827160 AraportID:AT4G15010 Length:378 Species:Arabidopsis thaliana


Alignment Length:369 Identity:75/369 - (20%)
Similarity:133/369 - (36%) Gaps:93/369 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VEKKTVPTHMKFVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNEGILS 71
            :|.....||.  :....|..|.|.:..|||.:||.:|:..  |..:..:||:|.::||:..|...
plant     5 LENHQFATHA--IAASASVSLGTALAYPLDTIKTIIQVGS--GPNKKLSSFQVFNRVLRFSGYSG 65

  Fly    72 LYNGLSAGLLRQATYTSAKMGVYQMELDWYRK-NFGNYPSMVASMTMGIVAGAFGAMCGNPAEVA 135
            ||:||.:..|.:.:...|:.|||::...:|:. ...||.|:..:...|:|.||...:..:|.|:.
plant    66 LYSGLGSLTLGRISGFGARFGVYEILTAFYKDGRHDNYVSVGEAFLAGLVGGAAETVMTSPFELI 130

  Fly   136 LIR--------------------------------------MMSDNRLMPEDRRNYKNVGDAF-- 160
            .:|                                      :.....|:......:.|:..|.  
plant   131 KVRKQVTAASRAPNASAVAETAPVSPMITKLLRRYTLDVKSLTQTVSLLSVLNHKHPNMTAALQE 195

  Fly   161 --------------------VRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQLHGYL 205
                                :.:...||..||||.....:.|..:...|..:::..:...:.|:.
plant   196 YPWMMTGTGNPPSAMDVKRPLDVASLEGYRALWRNLRSGLIRDCIYGGVFFSTWQFLHEAMVGWK 260

  Fly   206 SEGI--------------PLHLT-AALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDV 255
            :.|:              |:.:: ||.:||.:.:..|...|.|:||.|.:.:    |:|:.....
plant   261 AVGMNPLPSSEEEVGPLSPVAISLAAGISGAVAAAASHSFDTARTRAQCVIL----PKYTAKERK 321

  Fly   256 LKKVLKNEGAFAVWKGFTP---------YLMRMGPHTIFSFVFL 290
            ..|..|.......|.|..|         ..|||...::.|.|.:
plant   322 FLKWNKPGKRLERWTGIHPTDRNLLFRGIGMRMARSSVASTVIV 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 28/98 (29%)
PTZ00169 18..296 CDD:240302 72/358 (20%)
Mito_carr 109..205 CDD:278578 20/155 (13%)
Mito_carr 208..300 CDD:278578 24/107 (22%)
AT4G15010NP_567453.1 Mito_carr 10..97 CDD:395101 28/90 (31%)
Mito_carr 104..258 CDD:395101 19/153 (12%)
Mito_carr 275..378 CDD:395101 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.