DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Slc25a27

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_017173167.1 Gene:Slc25a27 / 74011 MGIID:1921261 Length:344 Species:Mus musculus


Alignment Length:281 Identity:80/281 - (28%)
Similarity:139/281 - (49%) Gaps:26/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PLDLLKTRMQI----------SGTLGTREYKNSFEVLSKVLKNEGILSLYNGLSAGLLRQATYTS 88
            ||||.|||:|:          .|.:.:..|:........:::.||.|.|:.|::..:.|...|:.
Mouse    52 PLDLTKTRLQMQGEAALARLGDGAVDSAPYRGMVRTALGIVQEEGFLKLWQGVTPAIYRHVVYSG 116

  Fly    89 AKMGVYQ--MELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRM-MSDNRLMPEDR 150
            .:|..|:  .|:.:.:....:|| :..|:..|::||..|....||.::..::| |...|.:....
Mouse   117 GRMVTYEHLREVVFGKSEDKHYP-LWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRRLEGKP 180

  Fly   151 RNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQ--LHGYLSEGIPLHL 213
            ..::.|..||.:|:.:.|:..||.|.:|.:.||.:|||..|.:|..:|:.  |:..|.:.|..|.
Mouse   181 LRFRGVHHAFAKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNISTHG 245

  Fly   214 TAALVSGLLTSVTSMPLDMAKTRI-QQMKVIDGKP-EYSGTIDVLKKVLKNEGAFAVWKGFTPYL 276
            .::|.|||:.|:...|.|:.|:|| .|.:...|:. .|..:.|.|.:.::.||..:::|||.|..
Mouse   246 LSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSADCLIQAVQGEGFLSLYKGFLPSW 310

  Fly   277 MRMG--------PHTIFSFVF 289
            :||.        |..:||..|
Mouse   311 LRMVKMGEVLFLPLLLFSLYF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 20/85 (24%)
PTZ00169 18..296 CDD:240302 80/281 (28%)
Mito_carr 109..205 CDD:278578 29/98 (30%)
Mito_carr 208..300 CDD:278578 29/92 (32%)
Slc25a27XP_017173167.1 Mito_carr 48..131 CDD:365909 20/78 (26%)
Mito_carr 138..232 CDD:365909 29/94 (31%)
Mito_carr 240..>314 CDD:365909 24/73 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.