DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and UCP1

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_068605.1 Gene:UCP1 / 7350 HGNCID:12517 Length:307 Species:Homo sapiens


Alignment Length:284 Identity:90/284 - (31%)
Similarity:142/284 - (50%) Gaps:12/284 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GTSGMLATCIVQPLDLLKTRMQISG---TLGTREYKNSFEVLSKVLKNEGILSLYNGLSAGLLRQ 83
            |.:..||..|..|||..|.|:|:.|   |.....||.....::.|:|.||.:.||:||.|||.||
Human    21 GIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQ 85

  Fly    84 ATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDNRLMPE 148
            .:..|.::|:|....::........||:.:.:..|:..|......|.|.||..:|:.:.:.|...
Human    86 ISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGI 150

  Fly   149 DRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQL--HGYLSEGIPL 211
            ..| |....:|:..|...||:..||:|..|.:.|::::|..:|.:|.|||...  :..|::.:|.
Human   151 KPR-YTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPC 214

  Fly   212 HLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKP-EYSGTIDVLKKVLKNEGAFAVWKGFTPY 275
            ||.:||::|...:..|.|:|:.|||.     |:..| :|....:...||..|||..|.:||..|.
Human   215 HLVSALIAGFCATAMSSPVDVVKTRF-----INSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPS 274

  Fly   276 LMRMGPHTIFSFVFLEQMNKAYSK 299
            .:|:|...:..||..||:.:..||
Human   275 FLRLGSWNVIMFVCFEQLKRELSK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 30/88 (34%)
PTZ00169 18..296 CDD:240302 88/279 (32%)
Mito_carr 109..205 CDD:278578 27/97 (28%)
Mito_carr 208..300 CDD:278578 32/93 (34%)
UCP1NP_068605.1 Mito_carr 10..104 CDD:278578 30/82 (37%)
Solcar 1 11..102 30/80 (38%)
Mito_carr 111..206 CDD:278578 27/95 (28%)
Solcar 2 111..201 27/90 (30%)
Solcar 3 210..295 30/89 (34%)
Mito_carr 215..300 CDD:278578 31/89 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.