DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Slc25a30

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_006519518.1 Gene:Slc25a30 / 67554 MGIID:1914804 Length:311 Species:Mus musculus


Alignment Length:256 Identity:79/256 - (30%)
Similarity:133/256 - (51%) Gaps:16/256 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FVMGGTSGMLATCIVQPLDLLKTRMQISGTLGT---RE--YKNSFEVLSKVLKNEGILSLYNGLS 77
            ||.||.:.:.|.|...|:||.|||:||.|....   ||  |:.....|.::.:.||:.:||:|::
Mouse     9 FVYGGLASITAECGTFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIGREEGLKALYSGIA 73

  Fly    78 AGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSD 142
            ..:||||:|.:.|:|.|| .|...........:::.::..||::|...:...||.:|..|||.:.
Mouse    74 PAMLRQASYGTIKIGTYQ-SLKRLAVERPEDETLLVNVVCGILSGVISSAIANPTDVLKIRMQAQ 137

  Fly   143 NRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQ--LHGYL 205
            |..:      ...:.|:|:.|.:.||...||:|...|..||.:|..|:|..|.:.|..  |.|.:
Mouse   138 NSAV------QGGMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLM 196

  Fly   206 SEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVI-DGK-PEYSGTIDVLKKVLKNEG 264
            .:.:..|..::...||:.::.|.|:|:.:||:...:.: ||: ..|.||:|.|.:|..:.|
Mouse   197 GDTVATHFLSSFTCGLVGALASNPVDVVRTRMMNQRALRDGRCAGYKGTLDCLLQVSVSAG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 34/94 (36%)
PTZ00169 18..296 CDD:240302 79/256 (31%)
Mito_carr 109..205 CDD:278578 28/97 (29%)
Mito_carr 208..300 CDD:278578 17/59 (29%)
Slc25a30XP_006519518.1 Mito_carr 6..96 CDD:365909 34/87 (39%)
Mito_carr 105..191 CDD:365909 26/91 (29%)
Mito_carr 199..>259 CDD:365909 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.