DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Tpc1

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:307 Identity:64/307 - (20%)
Similarity:125/307 - (40%) Gaps:36/307 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KFVMGGTSGMLATCIVQPLDLLKTRMQIS-------------GTLGTREYKNSFEVLSKVLKNEG 68
            :.:.||.|..:.....||||:||.|.|:.             |.| |.:|.:..:.:..:.:.||
  Fly    31 QMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGAL-TSKYTSIGQAVKTIYREEG 94

  Fly    69 ILSLYNGLSAGLLRQATYTSAKMGVY-QMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPA 132
            :|:.:.|.:...:....|...:...| |:.|...:.::......:::...|..||....:...|.
  Fly    95 MLAFWKGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIISTPL 159

  Fly   133 EVALIRMMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLM 197
            :|...|:::.     :..:.|:|...|...||:.||...::||....:.:...:......:|.|.
  Fly   160 DVIRTRLIAQ-----DTSKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLF 219

  Fly   198 KNQLHGYLS----EGIP----LHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTI- 253
            .:....:|.    ..:|    |.|.|:  ||:|:.....|.|:.|.|:|.......:..:..|: 
  Fly   220 SDWACAFLEVSDRSQLPTWTLLGLGAS--SGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQ 282

  Fly   254 -----DVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNK 295
                 |.|:..::.||...::||..|.|::....|...|...:::.:
  Fly   283 CHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQ 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 23/104 (22%)
PTZ00169 18..296 CDD:240302 64/306 (21%)
Mito_carr 109..205 CDD:278578 17/95 (18%)
Mito_carr 208..300 CDD:278578 23/98 (23%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 21/92 (23%)
PTZ00169 33..329 CDD:240302 64/303 (21%)
Mito_carr 153..222 CDD:278578 14/73 (19%)
Mito_carr 233..328 CDD:278578 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.