DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Dic4

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:276 Identity:82/276 - (29%)
Similarity:147/276 - (53%) Gaps:17/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGTSGMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNEGILSLYNGLSAGLLRQAT 85
            ||.:.|.....|.|:|::||.|||.     |:.::....:.::...:|.|..|:|.||.:|||.|
  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQ-----RQKRSILGTVKRIHSLKGYLGFYDGFSAAILRQMT 85

  Fly    86 YTSAKMGVYQMELDWYRK-NFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDNRLMPED 149
            .|:....||    |..:| .:.:..|.:..:.:|.||||.|:..|.|.::..:||.:|.:..|..
  Fly    86 STNIHFIVY----DTGKKMEYVDRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKEPPYK 146

  Fly   150 RRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQLHGYLS--EGIPLH 212
            |||||:|.|..:||.|:||..||::|....|.::.:....|:|.|.::|.::...:|  :|:|||
  Fly   147 RRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDGLPLH 211

  Fly   213 LTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLKNEGAFAVWKGFTPYLM 277
            ...:|.:.:::|..:.|||:.:|.:...:..:.:..:..::.:::     .|....::||.|.::
  Fly   212 FLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMR-----FGVMGPYRGFVPTIV 271

  Fly   278 RMGPHTIFSFVFLEQM 293
            |..|.|...||..||:
  Fly   272 RKAPATTLLFVLYEQL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 27/87 (31%)
PTZ00169 18..296 CDD:240302 82/276 (30%)
Mito_carr 109..205 CDD:278578 33/95 (35%)
Mito_carr 208..300 CDD:278578 21/86 (24%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 82/276 (30%)
Mito_carr 26..100 CDD:278578 26/82 (32%)
Mito_carr 104..201 CDD:278578 33/96 (34%)
Mito_carr 211..292 CDD:278578 18/82 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441900
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.