DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Mpcp2

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:292 Identity:71/292 - (24%)
Similarity:129/292 - (44%) Gaps:43/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FVMGGTSGMLATC-----IVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNEGILSLYNGLS 77
            |.:.|..|:| :|     .|.||||:|.|:|:.    ..:|||........:..||...|..|..
  Fly    62 FALCGIGGIL-SCGTTHTFVVPLDLVKCRLQVD----QAKYKNLVHGFKVTVAEEGARGLAKGWF 121

  Fly    78 AGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGA----FGAMCGNPAEVALIR 138
            ..||..:.....|.|:|::....|.:..|...:.:...::.:.|.|    |..:...|.|.|.::
  Fly   122 PTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVK 186

  Fly   139 MMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQLHG 203
            :.:    :|....|::   :|..:::|:|||.|.::|.:|...|.:...|::.|.:......|:.
  Fly   187 IQT----IPGYANNFR---EAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYK 244

  Fly   204 YL--------SEGIPLHLT--AALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKK 258
            |:        ::|..|.:|  |..::|:..:|.|.|.|:..:::.|.|   |....|        
  Fly   245 YVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAK---GASAIS-------- 298

  Fly   259 VLKNEGAFAVWKGFTPYLMRMGPHTIFS-FVF 289
            |.|:.|...:|.|.||.::.:|..|... |::
  Fly   299 VAKSLGFSGMWNGLTPRIIMIGTLTALQWFIY 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 27/94 (29%)
PTZ00169 18..296 CDD:240302 71/292 (24%)
Mito_carr 109..205 CDD:278578 20/99 (20%)
Mito_carr 208..300 CDD:278578 23/85 (27%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 25/84 (30%)
Mito_carr <175..245 CDD:278578 17/76 (22%)
Mito_carr 260..338 CDD:278578 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441821
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.