DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and SCaMC

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:308 Identity:74/308 - (24%)
Similarity:126/308 - (40%) Gaps:50/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VMGGTSGMLATCIVQPLDLLKTRMQI-SGTLGTREYKNSFEVLSKVLKNE-GILSLYNGLSAGLL 81
            |.||.:|.::.....|||.:|..:|: :..:|..|..:       ::.|| |..|::.|....:|
  Fly   290 VAGGIAGAVSRTCTAPLDRIKVYLQVQTQRMGISECMH-------IMLNEGGSRSMWRGNGINVL 347

  Fly    82 RQATYTSAKMGVYQMELDWYRKNFGN-YPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDNRL 145
            :.|..|:.|...|:......|.:.|: ..|:|.....|..||........|.||...|:..    
  Fly   348 KIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLAL---- 408

  Fly   146 MPEDRR--NYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMK---------N 199
                ||  .|..:.||.|:|.|.|||.:.:||.:|.:...:....:.||.|..:|         |
  Fly   409 ----RRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHDNN 469

  Fly   200 QLHGYLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQ----------------QMKVIDGKPE 248
            :...:|     :.|.....|..|..:.|.||.:.:||:|                .:|..|....
  Fly   470 EQPSFL-----VLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSG 529

  Fly   249 YSGTIDVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNKA 296
            ......:.:|:::.||...:::|.||..:::.|....|:|..|..::|
  Fly   530 EETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRA 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 23/91 (25%)
PTZ00169 18..296 CDD:240302 73/306 (24%)
Mito_carr 109..205 CDD:278578 28/106 (26%)
Mito_carr 208..300 CDD:278578 22/105 (21%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 22/86 (26%)
Mito_carr 375..463 CDD:278578 27/95 (28%)
Mito_carr 470..581 CDD:278578 23/113 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.