DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Bmcp

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:304 Identity:90/304 - (29%)
Similarity:146/304 - (48%) Gaps:37/304 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FVMGGTSGMLATCIVQPLDLLKTRMQISG-----TLGTREYKNSFEVLSKVLKNEGILSLYNGLS 77
            ||.||.:.:.|.....|:|..|||:||.|     :.....|:...:...|:.:.||:.:||:|:.
  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74

  Fly    78 AGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMV----------ASMTMGIVAGAFGAMCGNPA 132
            ..:||||||.:.|.|.|     :..|...|...::          :::.....|||..:...||.
  Fly    75 PAVLRQATYGTIKFGTY-----YTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPT 134

  Fly   133 EVALIRMMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLM 197
            :|..:||      ....:..:|.:...|..|.|.|||..||||..||..||:|:..|:|..|...
  Fly   135 DVLKVRM------QVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFC 193

  Fly   198 KNQLHGYLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVID----------GKPE-YSG 251
            |.||.....:.:..|..::.::.|.:::.|.|:|:.:||:...:.:.          ..|: |||
  Fly   194 KLQLMNAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSG 258

  Fly   252 TIDVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNK 295
            ::|...:.::|||..|::|||.|..:||||..|..|:..||:.|
  Fly   259 SLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 30/94 (32%)
PTZ00169 18..296 CDD:240302 90/304 (30%)
Mito_carr 109..205 CDD:278578 30/105 (29%)
Mito_carr 208..300 CDD:278578 29/99 (29%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 30/91 (33%)
Mito_carr <132..199 CDD:278578 27/72 (38%)
Mito_carr 204..303 CDD:278578 29/99 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.