DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and slc25a14

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_017208245.1 Gene:slc25a14 / 393133 ZFINID:ZDB-GENE-040426-749 Length:335 Species:Danio rerio


Alignment Length:285 Identity:99/285 - (34%)
Similarity:159/285 - (55%) Gaps:17/285 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTRE--YKNSFEVLSKVLKNEGILSLYNGLSAGL 80
            ||.||.:.::|.....|:||.|||:|:.|.....|  |:..|..|.::.:.||:.:||:|:|..|
Zfish    58 FVYGGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREEGVRALYSGISPAL 122

  Fly    81 LRQATYTSAKMGVYQMELDWYRKNFGNYP---SMVASMTMGIVAGAFGAMCGNPAEVALIRMMSD 142
            ||||:|.:.|:|.|    :..:|.|.::|   :||.::..|:|:|...:...||.:|..|||.:.
Zfish   123 LRQASYGTIKIGTY----NTLKKLFVSHPEEETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQ 183

  Fly   143 NRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQL--HGYL 205
            ..|:      ..::...|:.|.:.||...||||.:||..||.:|..|:|..|.:.|..|  .|.:
Zfish   184 GSLL------QGSMMSNFMNIYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGLM 242

  Fly   206 SEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLKNEGAFAVWK 270
            .:.:..|..::...||..::.|.|:|:.:||:...:|:.|.|.|.||:|.|.:..:|||.||::|
Zfish   243 GDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPLYKGTLDGLMQTWRNEGFFALYK 307

  Fly   271 GFTPYLMRMGPHTIFSFVFLEQMNK 295
            ||.|..:|:||..|..|:..||:.|
Zfish   308 GFWPNWLRLGPWNIIFFMTFEQLKK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 34/91 (37%)
PTZ00169 18..296 CDD:240302 99/285 (35%)
Mito_carr 109..205 CDD:278578 32/100 (32%)
Mito_carr 208..300 CDD:278578 33/88 (38%)
slc25a14XP_017208245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D892773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.