DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and PMP34

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:314 Identity:67/314 - (21%)
Similarity:131/314 - (41%) Gaps:64/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VMGGTSGMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNEGILSLYNGLSAGLLRQ 83
            |.|...|.:|.....|||.:::|:|:.   ...:.:::.:|:.:::..||..|||.||  |.:.|
  Fly    20 VSGAAGGCIAMSTFYPLDTVRSRLQLE---EAGDVRSTRQVIKEIVLGEGFQSLYRGL--GPVLQ 79

  Fly    84 ATYTSAKMGVYQMELDWYRKNF--------------GNYPSM---VASMTMGIVAGAFGAMCGNP 131
            :...|               ||              |..||.   :..:.:|.:||....:...|
  Fly    80 SLCIS---------------NFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTP 129

  Fly   132 AEVALIRMMSDNRLMPED--RRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVN--MVQLA 192
            ..|...|:...|.....|  .::|||:.:....:.:.||:..||.|.:|::   |:|:  .:|..
  Fly   130 FWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSL---MLVSNPALQFM 191

  Fly   193 SYSLMKNQLHGYLS---EGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQ-QMKVIDGKPEYS--- 250
            .|.::|..:..:..   ..:......|:.....| |.:.||.:.:|:.: :.|..|.||..|   
  Fly   192 MYEMLKRNIMRFTGGEMGSLSFFFIGAIAKAFAT-VLTYPLQLVQTKQRHRSKESDSKPSTSAGS 255

  Fly   251 -----GTIDVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNKAYSK 299
                 .|::::..:|:::|...:::|....:::    |:.:...   |..||.|
  Fly   256 TPRTESTLELMISILQHQGIRGLFRGLEAKILQ----TVLTAAL---MFMAYEK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 23/102 (23%)
PTZ00169 18..296 CDD:240302 64/309 (21%)
Mito_carr 109..205 CDD:278578 24/102 (24%)
Mito_carr 208..300 CDD:278578 20/101 (20%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 22/95 (23%)
Mito_carr 105..202 CDD:278578 23/99 (23%)
Mito_carr 214..303 CDD:278578 20/97 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442012
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.