DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Shawn

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:343 Identity:72/343 - (20%)
Similarity:133/343 - (38%) Gaps:81/343 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TSGMLATCIVQPLDLLKTRMQ--------------ISGTLG-----------------TREYKNS 56
            |..|:..|.:.|||::|||:|              .:|.:.                 ...:..:
  Fly    48 TGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGT 112

  Fly    57 FEVLSKVLKNEGILSLYNGLSAGLLRQATYTSAKMGVYQMELDWYRKNFGNY-------PSMVA- 113
            .:...|:.:.|||.||::|||..|:.....|.    :|.:..:.::..|.:.       |..:| 
  Fly   113 IDAFIKISRTEGIGSLWSGLSPTLISALPSTI----IYFVAYEQFKARFTDIHYKYTRRPDTIAH 173

  Fly   114 ------SMTMGIVAGAFGAM----CGNPAEVALIRMMSDNRLMPEDRRNYKNVGDAFVRIVKDEG 168
                  ...:.::||..|.:    |.:|.|:...:|.|       .|..:..:.....::|:.:|
  Fly   174 DIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQS-------QRMTHAEMFGTIRQVVQSQG 231

  Fly   169 VVALWRGCLPTVGRAMVVNMVQLASYSLMKNQLHGYLSEGIPLHLTAALVSGLLTSVTSMPLDMA 233
            |:.||||..||:.|.:..:.:....|..:|:.. |.:.........|..:||.:.:..:.|.|:.
  Fly   232 VLGLWRGLPPTILRDVPFSGIYWTCYEYLKSSF-GVVEPTFSFSFAAGAISGSVAATITTPFDVV 295

  Fly   234 KTRIQ-----QMKVIDGKPEYSGTIDV---LKKVLKNEGAFAVWKGFTPYLMRMGPH---TIFSF 287
            ||..|     :....|..|:...|..|   |..:.:..|..|::.|..|.|.::.|.   .|.||
  Fly   296 KTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASIYRMGGVPAIFSGLGPRLFKVAPACAIMISSF 360

  Fly   288 VF---------LEQMNKA 296
            .:         ::|.|::
  Fly   361 EYGKSFFYHYNIDQHNRS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 24/115 (21%)
PTZ00169 18..296 CDD:240302 72/341 (21%)
Mito_carr 109..205 CDD:278578 24/106 (23%)
Mito_carr 208..300 CDD:278578 24/109 (22%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 24/114 (21%)
Mito_carr 178..265 CDD:278578 21/94 (22%)
Mito_carr 268..371 CDD:278578 22/102 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.