DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Tyler

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:318 Identity:65/318 - (20%)
Similarity:115/318 - (36%) Gaps:114/318 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNEGILSLYNGLSAGLLRQATYTSA 89
            |::.|.:|.||:::|||:|....:..|      ..:||:     ....:|||...:.|.:.....
  Fly    56 GLITTFVVTPLEVVKTRVQTQHAIRQR------PTVSKL-----CYVYHNGLMTHVCRSSDICVP 109

  Fly    90 KMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDNRLMPEDRRNYK 154
            |.|                                                .|    |::.|..:
  Fly   110 KPG------------------------------------------------RD----PQNLRPLR 122

  Fly   155 NVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQL-HGYL------------- 205
            ...||||:||...|...||.|..||:..|:...::...:|..:||.| |.||             
  Fly   123 GAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKFEESGMKDQ 187

  Fly   206 -------------SEGIPLHLTA-----------ALVSGL------LTSVTSMPLDMAKTRIQQM 240
                         :.||.:..||           .:.||:      :|::|  |::|.:.::|..
  Fly   188 VPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAIT--PIEMVRIKMQSE 250

  Fly   241 KVIDGKPEYSGTIDVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNKAYS 298
            .:     .|:....||:.:::..|...:|:|:.|.:||..|.:...:...|.:.:|:|
  Fly   251 YM-----TYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKRAFS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 18/82 (22%)
PTZ00169 18..296 CDD:240302 63/314 (20%)
Mito_carr 109..205 CDD:278578 21/96 (22%)
Mito_carr 208..300 CDD:278578 24/108 (22%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 38/177 (21%)
Mito_carr 216..302 CDD:278578 18/92 (20%)
Mito_carr 306..429 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.