DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and CG8323

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:300 Identity:84/300 - (28%)
Similarity:144/300 - (48%) Gaps:22/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTR-----EYKNSFEVLSKVLKNEGILSLYNGLS 77
            ||:||.:.:.||....|::::|||:|:.|.|..|     .||........|.||:||..|..||:
  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLA 70

  Fly    78 AGLLRQATYTSAKMGVYQ--MELDWYRKNFGNYPSMVASMTMGIVAGAFGAM--CGNPAEVALIR 138
            ..|..|....|.::.:|.  ||..|.....|.     .|..||::.||.|.:  |...:...||:
  Fly    71 PALYFQFIINSFRLSIYSEAMERRWMHNRKGE-----VSYGMGLLWGAIGGVVGCYFSSPFFLIK 130

  Fly   139 MMSDNRLMPEDRRNYK----NVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKN 199
            ....::...:....|:    ::.||..:|....||..||||.:..:.||.:.:..|:|::...|.
  Fly   131 TQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKA 195

  Fly   200 QLHGY--LSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKV-IDGKP-EYSGTIDVLKKVL 260
            .|..|  :::......:|.|::|.:.||...|.|:..||:....| .:|:. .|.|.:|...|:|
  Fly   196 LLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKIL 260

  Fly   261 KNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNKAYSKH 300
            ::||.:.::|||....:|:.||:....:|.:::....:|:
  Fly   261 RSEGVYGMYKGFWANYLRIAPHSTLVLLFFDELVAVRTKY 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 32/96 (33%)
PTZ00169 18..296 CDD:240302 83/294 (28%)
Mito_carr 109..205 CDD:278578 26/103 (25%)
Mito_carr 208..300 CDD:278578 25/93 (27%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 27/80 (34%)
PTZ00169 5..293 CDD:240302 83/291 (29%)
Mito_carr 101..200 CDD:278578 26/103 (25%)
Mito_carr 206..301 CDD:278578 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.