DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Slc25a30

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001013205.1 Gene:Slc25a30 / 361074 RGDID:1359702 Length:291 Species:Rattus norvegicus


Alignment Length:287 Identity:96/287 - (33%)
Similarity:154/287 - (53%) Gaps:16/287 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FVMGGTSGMLATCIVQPLDLLKTRMQISGTLGT---RE--YKNSFEVLSKVLKNEGILSLYNGLS 77
            ||.||.:.:.|.|...|:||.|||:||.|....   ||  |:.....|.::.:.||:.:||:|::
  Rat     9 FVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFREIRYRGMLHALMRIGREEGLRALYSGIA 73

  Fly    78 AGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSD 142
            ..:||||:|.:.|:|.|| .|...........:::.::..||::|...:...||.:|..|||.:.
  Rat    74 PAMLRQASYGTIKIGTYQ-SLKRLAVERPEDETLLINVVCGILSGVISSAIANPTDVLKIRMQAQ 137

  Fly   143 NRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQ--LHGYL 205
            |..:....     :|: |:.|.:.||...||:|...|..||.:|..|:|..|.:.|..  |.|.:
  Rat   138 NSAVQGGM-----IGN-FISIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLM 196

  Fly   206 SEGIPLHLTAALVSGLLTSVTSMPLDMAKTR-IQQMKVIDGK-PEYSGTIDVLKKVLKNEGAFAV 268
            .:.:..|..::...||:.::.|.|:|:.:|| :.|..:.||: ..|.||:|.|.:..||||.||:
  Rat   197 GDTVSTHFLSSFTCGLVGALASNPVDVVRTRMMNQRDLRDGRCSGYKGTLDCLLQTWKNEGFFAL 261

  Fly   269 WKGFTPYLMRMGPHTIFSFVFLEQMNK 295
            :|||.|..:|:||..|..|:..||:.|
  Rat   262 YKGFWPNWLRLGPWNIIFFLTYEQLKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 34/94 (36%)
PTZ00169 18..296 CDD:240302 96/287 (33%)
Mito_carr 109..205 CDD:278578 28/97 (29%)
Mito_carr 208..300 CDD:278578 34/90 (38%)
Slc25a30NP_001013205.1 Solcar 1 7..96 34/87 (39%)
PTZ00169 9..289 CDD:240302 96/287 (33%)
Solcar 2 104..189 26/90 (29%)
Solcar 3 198..289 34/91 (37%)
Mito_carr 199..289 CDD:395101 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.