DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and CG8026

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:311 Identity:81/311 - (26%)
Similarity:141/311 - (45%) Gaps:44/311 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EKKTVPTHMKF---VMGGTSGMLATCIVQPLDLLKTRMQISG--TLGTREYKNSFEVLSKVLKNE 67
            :|..|..|:|:   |.|.:.|:::|.|:.||||:|.|..::.  |....:|:......:.:.:.|
  Fly    13 KKFNVFAHVKYEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFRQE 77

  Fly    68 GILSLYNGLSAGLLRQATYTSAKMGVYQMELDWYR--KNF--GNYPSMVASMTMGIVA----GAF 124
            |...||.|::..:..    :.:..|:|.|   :|.  |.|  |...:|....||.::|    |..
  Fly    78 GFRGLYKGVTPNVWG----SGSSWGLYFM---FYNTIKTFIQGGNTTMPLGPTMNMLAAAESGIL 135

  Fly   125 GAMCGNPAEVALIR--MMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVN 187
            ..:..||..|...|  :..|.....|    |:.:..|..:|.|:||:..|:||.:|  |...|.:
  Fly   136 TLLLTNPIWVVKTRLCLQCDAASSAE----YRGMIHALGQIYKEEGIRGLYRGFVP--GMLGVSH 194

  Fly   188 -MVQLASYSLMKNQLHGYLSEGIPL--------HLTAALVSGLLTSVTSMPLDMAKTRIQQMKVI 243
             .:|..:|..:||..:.|  ..:|:        :|..|.||.|:.:..:.|..:.:.|:|     
  Fly   195 GAIQFMTYEELKNAYNEY--RKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQ----- 252

  Fly   244 DGKPEYSGTIDVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMN 294
            |....|:||.|.:|:..:.||....:||....|.|:.|..:.:|:..|.::
  Fly   253 DHHHRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 28/106 (26%)
PTZ00169 18..296 CDD:240302 77/301 (26%)
Mito_carr 109..205 CDD:278578 27/102 (26%)
Mito_carr 208..300 CDD:278578 24/95 (25%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 77/293 (26%)
Mito_carr 23..115 CDD:278578 25/98 (26%)
Mito_carr 119..213 CDD:278578 27/101 (27%)
Mito_carr 220..307 CDD:278578 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.