DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Dic3

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:276 Identity:95/276 - (34%)
Similarity:149/276 - (53%) Gaps:19/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGTSGMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNEGILSLYNGLSAGLLRQAT 85
            ||....:|.....|:||:|.::|   |....:.|...|:|..:.:..|||..|||:||...||.|
  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQ---TQSQADRKTVGEILKGIHERSGILGFYNGISASWFRQLT 76

  Fly    86 YTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDNRLMPEDR 150
            ||:.:..:|:.     .|::.:...:.:.|.:...||..|.:.|.|.:|..:|:.:|.:|..|.|
  Fly    77 YTTTRFALYEA-----GKDYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEEKR 136

  Fly   151 RNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQLH---GYLSEGIPLH 212
            ||||:|.|...||.|:|||.:|:||.:|.|.||:::.:...|:|..:|..|.   | ..||:|||
  Fly   137 RNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATG-AGEGVPLH 200

  Fly   213 LTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKP-EYSGTIDVLKKVLKNEGAFAVWKGFTPYL 276
            ...:.::|.:..|.:.|||:.||..     ::.:| |:||.........| :|..|.:|||.|.|
  Fly   201 FATSTIAGCIAVVITQPLDVIKTTF-----MNAQPGEFSGIGGAFLSTAK-QGPLAFYKGFIPAL 259

  Fly   277 MRMGPHTIFSFVFLEQ 292
            :|:.|:||.:||..||
  Fly   260 IRVSPNTIITFVLYEQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 27/86 (31%)
PTZ00169 18..296 CDD:240302 95/276 (34%)
Mito_carr 109..205 CDD:278578 36/98 (37%)
Mito_carr 208..300 CDD:278578 31/86 (36%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 93/274 (34%)
Mito_carr 15..91 CDD:278578 27/83 (33%)
Mito_carr 93..187 CDD:278578 34/93 (37%)
Mito_carr 200..281 CDD:278578 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441906
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.