DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Ucp4A

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:301 Identity:89/301 - (29%)
Similarity:147/301 - (48%) Gaps:29/301 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 THMKFVMGGTSGMLATCIVQPLDLLKTRMQISGT-------LGTREYKNSFEVLSKVLKNEGILS 71
            |::..|:..:...|||   .||||.|||:||.|.       ....:|:........:.:.||.|.
  Fly    43 TYIVSVVAASIAELAT---YPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALK 104

  Fly    72 LYNGLSAGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMV----ASMTMGIVAGAFGAMCGNPA 132
            |:.|::..|.|...|:..::..|    |..||.|....:..    .|...|:.|||......:||
  Fly   105 LWQGVTPALYRHVVYSGVRICSY----DLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPA 165

  Fly   133 EV--ALIRMMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYS 195
            ::  ..|:|....|||.|..|.: :.|.||.:||:..|:..||:|.:|.|.||.:||:..|.:|.
  Fly   166 DLVKVQIQMEGRRRLMGEPPRVH-SAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYD 229

  Fly   196 LMKNQLHGYLSEGIP----LHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPE--YSGTID 254
            .:|:.:...|.  :|    :|:.|::.:|.:.::...|.|:.||||......:....  |.|::|
  Fly   230 TIKHLIMNRLQ--MPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVD 292

  Fly   255 VLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNK 295
            .|::.:..||..|::|||.|..:||.|.::..::..||:.|
  Fly   293 CLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 29/100 (29%)
PTZ00169 18..296 CDD:240302 88/297 (30%)
Mito_carr 109..205 CDD:278578 32/101 (32%)
Mito_carr 208..300 CDD:278578 27/94 (29%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 89/301 (30%)
Mito_carr 39..138 CDD:278578 29/101 (29%)
Mito_carr 142..239 CDD:278578 32/97 (33%)
Mito_carr 248..336 CDD:278578 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441677
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.