DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Ant2

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:208 Identity:61/208 - (29%)
Similarity:90/208 - (43%) Gaps:30/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GVEKKTVPTHMKF--------VMGGTSGMLATCIVQPLDLLKTRMQIS-GTLGTREYKNSFEVLS 61
            ||:|     |.:|        ..||.:|..:.|.|.|||..:||:... |..|.||:....:.|.
  Fly   112 GVDK-----HKQFWRHFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGGNREFNGLIDCLM 171

  Fly    62 KVLKNEGILSLYNGLSAGLLRQATYTSAKMGVYQMELDWY--RKNFGNYPSMVASMTMGIVAGAF 124
            ||:|::|.:.||.|....:.....|.:|..|.|....|:.  .|:...|.|...:..:..|||  
  Fly   172 KVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWAIAQVVTTVAG-- 234

  Fly   125 GAMCGNPAEVALIRMMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTV----GRAMV 185
              :...|.:....|||..:.| .:....|||....::.|.|.||:.|.::|.|..:    |.|:|
  Fly   235 --IASYPFDTVRRRMMMQSGL-KKSEMVYKNTAHCWLVIAKQEGIGAFFKGALSNIIRGTGGALV 296

  Fly   186 VNMVQLASYSLMK 198
                 ||.|..||
  Fly   297 -----LALYDEMK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 30/108 (28%)
PTZ00169 18..296 CDD:240302 57/196 (29%)
Mito_carr 109..205 CDD:278578 27/94 (29%)
Mito_carr 208..300 CDD:278578
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 61/208 (29%)
Mito_carr 17..111 CDD:278578
Mito_carr 119..215 CDD:278578 28/95 (29%)
Mito_carr 218..307 CDD:278578 28/97 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.