DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and SLC25A30

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_005266378.1 Gene:SLC25A30 / 253512 HGNCID:27371 Length:293 Species:Homo sapiens


Alignment Length:251 Identity:76/251 - (30%)
Similarity:131/251 - (52%) Gaps:22/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTRE-----YKNSFEVLSKVLKNEGILSLYNGLS 77
            ||.||.:.:.|.|...|:||.|||:||.|.....:     |:.....|.::.:.||:.:||:|::
Human     9 FVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIA 73

  Fly    78 AGLLRQATYTSAKMGVYQMELDWYRKNFGNYP---SMVASMTMGIVAGAFGAMCGNPAEVALIRM 139
            ..:||||:|.:.|:|.||.    .::.|...|   ::..::..||::|...:...||.:|..|||
Human    74 PAMLRQASYGTIKIGTYQS----LKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRM 134

  Fly   140 MSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQ--LH 202
            .:.:..:....     :|: |:.|.:.||...||:|...|..||.:|..|:|..|.:.|..  |.
Human   135 QAQSNTIQGGM-----IGN-FMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILS 193

  Fly   203 GYLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVI-DGK-PEYSGTIDVL 256
            |.:.:.:..|..::...||..::.|.|:|:.:||:...:|: ||: ..|:||:|.|
Human   194 GLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 32/94 (34%)
PTZ00169 18..296 CDD:240302 76/251 (30%)
Mito_carr 109..205 CDD:278578 28/100 (28%)
Mito_carr 208..300 CDD:278578 16/51 (31%)
SLC25A30XP_005266378.1 Mito_carr 5..100 CDD:278578 32/94 (34%)
Mito_carr 102..191 CDD:278578 25/94 (27%)
Mito_carr 199..>252 CDD:278578 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.