DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and slc-25A10

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_509133.1 Gene:slc-25A10 / 180940 WormBaseID:WBGene00019656 Length:290 Species:Caenorhabditis elegans


Alignment Length:292 Identity:95/292 - (32%)
Similarity:156/292 - (53%) Gaps:39/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KFVMGGTSGMLATCIVQPLDLLKTRMQISG----TLGTREYKNSFEVLSKVLKNEGILSLYNGLS 77
            ::..||.:|.:|.|...||||||.::|...    |:|        ::..|:.||:|||:.|||:|
 Worm    11 RWYFGGVAGAMAACCTHPLDLLKVQLQTQQQGKLTIG--------QLSLKIYKNDGILAFYNGVS 67

  Fly    78 AGLLRQATYTSAKMGVYQ---------MELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAE 133
            |.:|||.||::.:.|:|:         ..|.:|:|      :::|..     |||.|.|.|.|.:
 Worm    68 ASVLRQLTYSTTRFGIYETVKKQLPQDQPLPFYQK------ALLAGF-----AGACGGMVGTPGD 121

  Fly   134 VALIRMMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMK 198
            :..:||.:|::|..|.|||||:..|..|||.::||.:.::.|......||:::.:.||:.|..:|
 Worm   122 LVNVRMQNDSKLPLEQRRNYKHALDGLVRITREEGFMKMFNGATMATSRAILMTIGQLSFYDQIK 186

  Fly   199 NQL--HGYLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLK 261
            ..|  .|...:.:..|..:::.:..:.:|.:.|||:.|||:  |....|  |:.|.:|......|
 Worm   187 QTLISSGVAEDNLQTHFASSISAASVATVMTQPLDVMKTRM--MNAAPG--EFKGILDCFMFTAK 247

  Fly   262 NEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQM 293
             .|....:|||.|...|:.|||:.:|:|.||:
 Worm   248 -LGPMGFFKGFIPAWARLAPHTVLTFIFFEQL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 35/103 (34%)
PTZ00169 18..296 CDD:240302 95/291 (33%)
Mito_carr 109..205 CDD:278578 33/97 (34%)
Mito_carr 208..300 CDD:278578 27/86 (31%)
slc-25A10NP_509133.1 PTZ00169 3..279 CDD:240302 95/292 (33%)
Mito_carr 15..91 CDD:278578 32/83 (39%)
Mito_carr 95..193 CDD:278578 35/108 (32%)
Mito_carr 214..283 CDD:278578 26/70 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.