DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and Slc25a10

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:284 Identity:90/284 - (31%)
Similarity:147/284 - (51%) Gaps:14/284 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KFVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLS-KVLKNEGILSLYNGLSAGL 80
            ::..||.:...|.|...||||||..:|..     :|.|.....:: :|::.:|.|:|||||||.|
  Rat     8 RWYFGGLASCGAACCTHPLDLLKVHLQTQ-----QEVKLRMTGMALQVVRTDGFLALYNGLSASL 67

  Fly    81 LRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDNRL 145
            .||.||:..:..:|:...|:..|:........:.:.:|.::|..|...|.||::..:||.:|.:|
  Rat    68 CRQMTYSLTRFAIYETMRDYMTKDSQGPLPFYSKVLLGGISGLTGGFVGTPADLVNVRMQNDMKL 132

  Fly   146 MPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQL--HGYLSEG 208
            ....||||.:..|...|:.::||:..|:.|......|..:|.:.||:.|...|..:  .||||:.
  Rat   133 PLSQRRNYSHALDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDN 197

  Fly   209 IPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLKNEGAFAVWKGFT 273
            |..|..::.::|...:....|||:.|||:     ::.|.||.|......:..| .|..|.:||..
  Rat   198 IFTHFLSSFIAGGCATFLCQPLDVLKTRL-----MNSKGEYQGVFHCAVETAK-LGPQAFFKGLV 256

  Fly   274 PYLMRMGPHTIFSFVFLEQMNKAY 297
            |..:|:.|||:.:|:||||:.|.:
  Rat   257 PAGVRLVPHTVLTFMFLEQLRKHF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 31/91 (34%)
PTZ00169 18..296 CDD:240302 89/280 (32%)
Mito_carr 109..205 CDD:278578 27/97 (28%)
Mito_carr 208..300 CDD:278578 29/90 (32%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 31/84 (37%)
Mito_carr 94..189 CDD:395101 26/94 (28%)
Mito_carr 197..283 CDD:395101 29/90 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.