DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18418 and SLC25A10

DIOPT Version :9

Sequence 1:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens


Alignment Length:224 Identity:68/224 - (30%)
Similarity:105/224 - (46%) Gaps:25/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KFVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLS-KVLKNEGILSLYNGLSAGL 80
            ::..||.:...|.|...||||||..:|..     :|.|.....:: :|::.:|||:||:||||.|
Human     9 RWYFGGLASCGAACCTHPLDLLKVHLQTQ-----QEVKLRMTGMALRVVRTDGILALYSGLSASL 68

  Fly    81 LRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDNRL 145
            .||.||:..:..:|:...|...|...........:.:|.|:|..|...|.||::..:||.:|.:|
Human    69 CRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKL 133

  Fly   146 MPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQL---------------ASYS 195
            ....||||.:..|...|:.::||:..|:.|......|..:|.:.||               |..|
Human   134 PQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLYCRWMCHVPVPAPGCAEDS 198

  Fly   196 LMKNQLHGYLSEGIPLHL--TAALVSGLL 222
              .::|.|.:|...||..  :.|..||||
Human   199 --PDELQGGVSGRFPLRRGDSEARASGLL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 31/91 (34%)
PTZ00169 18..296 CDD:240302 68/223 (30%)
Mito_carr 109..205 CDD:278578 29/110 (26%)
Mito_carr 208..300 CDD:278578 7/17 (41%)
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 31/84 (37%)
Mito_carr 95..179 CDD:278578 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.