DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and SLC25A14

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001269126.1 Gene:SLC25A14 / 9016 HGNCID:10984 Length:353 Species:Homo sapiens


Alignment Length:320 Identity:97/320 - (30%)
Similarity:155/320 - (48%) Gaps:59/320 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQISATTGE-------YKSSFDCLLKVFKNEGILALYNGLS 73
            ::.||||.::......|:||.|||:|:...:.:       |:..|..|.::.|.||:||||:|::
Human    41 FVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIA 105

  Fly    74 AGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSD 138
            ..|:|||:|.|.::|.||.....:.::.. ..|:|.:|..|:::|...:...||.:|..|||.:.
Human   106 PALLRQASYGTIKIGIYQSLKRLFVERLE-DETLLINMICGVVSGVISSTIANPTDVLKIRMQAQ 169

  Fly   139 NRLPPAERRNYTG-VLNAFVRIVKDEGVITLWK--------GC---------------------- 172
            ..|       :.| ::.:|:.|.:.||...||:        ||                      
Human   170 GSL-------FQGSMIGSFIDIYQQEGTRGLWRCLCSKAVTGCVLWLMPVIPALWEANAGGSLEG 227

  Fly   173 -MPTVGRAMIVNMVQLASYSQLKAAFSEYFSGLS-----LHIAAAMMSGLLTTIASMPLDMAKTR 231
             :||..||.||..|:|..|...|...  ..||:.     .|..::...||...:||.|:|:.:||
Human   228 VVPTAQRAAIVVGVELPVYDITKKHL--ILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTR 290

  Fly   232 IQQQKTAE-----YKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTK 286
            :..|:...     ||||:|.::|:.|:||..:|:|||.|...||||..:..||..|||.:
Human   291 MMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKR 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 97/320 (30%)
Mito_carr 19..90 CDD:278578 29/77 (38%)
Mito_carr 104..201 CDD:278578 31/128 (24%)
Mito_carr 207..284 CDD:278578 31/81 (38%)
SLC25A14NP_001269126.1 Mito_carr 37..133 CDD:278578 31/91 (34%)
PTZ00169 41..351 CDD:240302 97/320 (30%)
Mito_carr 134..254 CDD:278578 31/129 (24%)
Mito_carr 262..351 CDD:278578 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D892773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.