DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and OAC1

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_012802.1 Gene:OAC1 / 853739 SGDID:S000001603 Length:324 Species:Saccharomyces cerevisiae


Alignment Length:311 Identity:103/311 - (33%)
Similarity:161/311 - (51%) Gaps:21/311 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IEK---KSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQI----SATTGE-YKSSFDCLLKVFK 61
            |||   :.|..:..::.||||..:...:..|::|:|.|||:    ||:..: ||:....:..:||
Yeast    12 IEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK 76

  Fly    62 NEGILALYNGLSAGLMRQATYTTARMGFYQMEIDAYRKQF--NAPPTVLASMGMGILAGA----F 120
            ||||..|..||:|..:.|.....:|:|||:....:..:.|  :..|..:.|:|:.:.:||    .
Yeast    77 NEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGII 141

  Fly   121 GAMFGNPAEVALIRMMSDNR-LPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNM 184
            ||:.|:|..:...|:.|.:. :...|:.:||||.|..|.|.|.|||..|::|....:.|....:.
Yeast   142 GAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206

  Fly   185 VQLASYSQLKAAFSE---YFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDV 246
            |||..|:..|....:   ...|.:||:.|:.:|||...:...|.|:..|||..||...|||.:|.
Yeast   207 VQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDC 271

  Fly   247 LMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHI---VLG 294
            |:|..:.||:.:|:|||...:.|:.|||:....|:||..|....|   |||
Yeast   272 LVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIESRVLG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 94/285 (33%)
Mito_carr 19..90 CDD:278578 27/75 (36%)
Mito_carr 104..201 CDD:278578 31/104 (30%)
Mito_carr 207..284 CDD:278578 30/76 (39%)
OAC1NP_012802.1 PTZ00169 26..294 CDD:240302 87/267 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.