DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Slc25a27

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_006244672.1 Gene:Slc25a27 / 85262 RGDID:620787 Length:365 Species:Rattus norvegicus


Alignment Length:322 Identity:84/322 - (26%)
Similarity:142/322 - (44%) Gaps:47/322 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PGYMMYINGGLAGMLGTCIVQPLDLVKTRMQIS-----ATTGE-------YKSSFDCLLKVFKNE 63
            |....::..|.|..:......||||.|||:|:.     |..|:       |:......|.:.:.|
  Rat    17 PRTSKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALAKLGDGAMESAPYRGMMRTALGIVQEE 81

  Fly    64 GILALYNGLSAGLMRQATYTTARMGFYQ--MEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGN 126
            |.|.|:.|::..:.|...|:..||..|:  .|:...:.:....|...:.:| |::||..|....|
  Rat    82 GFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIG-GMMAGVIGQFLAN 145

  Fly   127 PAEVALIRM-MSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASY 190
            |.::..::| |...|....:...:.||.:||.:|:.:.|:..||.|.:|.:.||.:|||..|.:|
  Rat   146 PTDLVKVQMQMEGKRRLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTY 210

  Fly   191 SQLKAAFSEYF-------SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAE------YKG 242
            ..:|    .|.       ..::.|..:::.|||:.:|...|.|:.|:||..|...:      ||.
  Rat   211 DTVK----HYLVLNTALEDNIATHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKS 271

  Fly   243 TMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAF--------------IFLEQLTKAYKH 290
            :.|.:::..:.||..||:|||.|...|:.....|.|              :|...|:..:.|
  Rat   272 STDCVIQAVQGEGFLSLYKGFLPSWLRMVKTGRFCFFLCFLYISLTCTLQVFFILLSDVWPH 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 82/312 (26%)
Mito_carr 19..90 CDD:278578 23/82 (28%)
Mito_carr 104..201 CDD:278578 29/97 (30%)
Mito_carr 207..284 CDD:278578 26/96 (27%)
Slc25a27XP_006244672.1 Mito_carr 20..119 CDD:278578 25/98 (26%)
Mito_carr 122..218 CDD:278578 30/100 (30%)
Mito_carr 224..311 CDD:278578 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.