DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and DIC1

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_013452.1 Gene:DIC1 / 851063 SGDID:S000004340 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:281 Identity:93/281 - (33%)
Similarity:146/281 - (51%) Gaps:25/281 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQATYT 83
            ||.||:..|.:..||||.|.|:|  |......:.|..|..:..|||::.||:||||.::||.|||
Yeast    20 GGAAGIFATMVTHPLDLAKVRLQ--AAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQCTYT 82

  Fly    84 TARMGFYQMEIDAYRKQFNAPPTVLASMG----MGILAGAFGAMFGNPAEVALIRMMSDNRLPPA 144
            |.|.|.|.:     .|:...|...|.:|.    ..:.:||.|.:.||.|:|..|||.:|:.|..|
Yeast    83 TVRFGAYDL-----LKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIRMQNDSALEAA 142

  Fly   145 ERRNYTGVLNAFVRIVKDEGVI-TLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYF------- 201
            :||||...::...:|.:.||.: ||:.|..|.:.|.:::...|:.:|.    .|..|.       
Yeast   143 KRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYD----VFKNYLVTKLDFD 203

  Fly   202 -SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTP 265
             |....|:.|::::||:.|....|.|:.|||| ...:.:::..:.:|....:.||.:.:::|:.|
Yeast   204 ASKNYTHLTASLLAGLVATTVCSPADVMKTRI-MNGSGDHQPALKILADAVRKEGPSFMFRGWLP 267

  Fly   266 YLCRLGPHTVFAFIFLEQLTK 286
            ...||||.|:..|..:|||.|
Yeast   268 SFTRLGPFTMLIFFAIEQLKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 93/281 (33%)
Mito_carr 19..90 CDD:278578 32/70 (46%)
Mito_carr 104..201 CDD:278578 31/101 (31%)
Mito_carr 207..284 CDD:278578 23/76 (30%)
DIC1NP_013452.1 Mito_carr 20..94 CDD:395101 33/80 (41%)
Mito_carr 100..200 CDD:395101 31/103 (30%)
Mito_carr 203..289 CDD:395101 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.