DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and SLC25A11

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_024306762.1 Gene:SLC25A11 / 8402 HGNCID:10981 Length:342 Species:Homo sapiens


Alignment Length:324 Identity:161/324 - (49%)
Similarity:199/324 - (61%) Gaps:38/324 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQIS---ATTGEYKSSFDCLLKVFKNEGILALY 69
            ::.|..:.::.||||||..|..||||||||.|||:|   |.|.|||:||..|..:.|.||:..:|
Human    17 RTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIY 81

  Fly    70 NG----------------------------LSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPT 106
            .|                            |||||:|||||||.|:|.|.:..:........||.
Human    82 TGYWGLRMEGRLWVGSSRPWPDMLTPLLLRLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPG 146

  Fly   107 VLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKG 171
            .|....:|:.|||.||..|.|||||||||.:|.|||..:||.|..|.||.:||.::|||:|||:|
Human   147 FLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRG 211

  Fly   172 CMPTVGRAMIVNMVQLASYSQLKAAF--SEYFS-GLSLHIAAAMMSGLLTTIASMPLDMAKTRIQ 233
            |:||:.||::||..|||||||.|...  |.||| .:..|..|:|:|||:||.||||:|:||||||
Human   212 CIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQ 276

  Fly   234 QQK----TAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHIVL 293
            ..:    ..|||..:|||.||.:.||..|||||||||..|||||||..||||||:.||||.:.|
Human   277 NMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 155/308 (50%)
Mito_carr 19..90 CDD:278578 46/101 (46%)
Mito_carr 104..201 CDD:278578 54/98 (55%)
Mito_carr 207..284 CDD:278578 50/80 (63%)
SLC25A11XP_024306762.1 Mito_carr 24..>85 CDD:278578 32/60 (53%)
Mito_carr 144..241 CDD:278578 53/96 (55%)
Mito_carr 243..337 CDD:278578 56/93 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155720
Domainoid 1 1.000 119 1.000 Domainoid score I5800
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S777
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0004406
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101430
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2168
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.670

Return to query results.
Submit another query.