DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and AT5G19760

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_197477.1 Gene:AT5G19760 / 832096 AraportID:AT5G19760 Length:298 Species:Arabidopsis thaliana


Alignment Length:294 Identity:127/294 - (43%)
Similarity:172/294 - (58%) Gaps:33/294 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQI------SATTGEYKSSFDCLLKVFKNEGILALYNGLSA 74
            ::|||.:|||.||::||:|::|.|:|:      |.||           .:.||||:.|.|.||||
plant    18 FVNGGASGMLATCVIQPIDMIKVRIQLGQGSAASITT-----------NMLKNEGVGAFYKGLSA 71

  Fly    75 GLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGM-GILAGAFGAMFGNPAEVALIRMMSD 138
            ||:|||||||||:|.:::......:..:..|..|....: |:.|||.||..|:||::|||||.:|
plant    72 GLLRQATYTTARLGSFKLLTAKAIESNDGKPLPLYQKALCGLTAGAIGACVGSPADLALIRMQAD 136

  Fly   139 NRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEY--- 200
            |.||.|:|||||...:|..||..||||:.|||||.|||.|||.:||..||||.|    .:||   
plant   137 NTLPLAQRRNYTNAFHALTRISADEGVLALWKGCGPTVVRAMALNMGMLASYDQ----SAEYMRD 197

  Fly   201 ---FSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQ-QKTAE----YKGTMDVLMKVSKNEGIA 257
               |..:|..:.|:.:||......|:|.|..||:||: |..|:    |.|::|..||..|..|..
plant   198 NLGFGEMSTVVGASAVSGFCAAACSLPFDFVKTQIQKMQPDAQGKYPYTGSLDCAMKTLKEGGPL 262

  Fly   258 SLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHI 291
            ..:.||..|..|:.||.:..:|||.|:||..|.|
plant   263 KFYSGFPVYCVRIAPHVMMTWIFLNQITKFQKKI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 124/288 (43%)
Mito_carr 19..90 CDD:278578 38/76 (50%)
Mito_carr 104..201 CDD:278578 53/103 (51%)
Mito_carr 207..284 CDD:278578 28/81 (35%)
AT5G19760NP_197477.1 Mito_carr 13..87 CDD:395101 39/79 (49%)
Mito_carr 101..199 CDD:395101 53/101 (52%)
Mito_carr 210..292 CDD:395101 30/81 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2332
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I1186
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D892773at2759
OrthoFinder 1 1.000 - - FOG0004406
OrthoInspector 1 1.000 - - otm2939
orthoMCL 1 0.900 - - OOG6_101430
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2168
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.