DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and DIC3

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_196509.1 Gene:DIC3 / 830806 AraportID:AT5G09470 Length:337 Species:Arabidopsis thaliana


Alignment Length:337 Identity:108/337 - (32%)
Similarity:163/337 - (48%) Gaps:60/337 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GYMMYINGGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFD---------------------- 54
            |:..::.||:|.::...:..||||:|.|||:.   ||:..|.|                      
plant     2 GFKPFLEGGIAAIIAGALTHPLDLIKVRMQLQ---GEHSFSLDQNPNPNLSLDHNLPVKPYRPVF 63

  Fly    55 ---------CLL----------------------KVFKNEGILALYNGLSAGLMRQATYTTARMG 88
                     .||                      .:.|.||..||::|:||.::||..|:..|||
plant    64 ALDSLIGSISLLPLHIHAPSSSTRSVMTPFAVGAHIVKTEGPAALFSGVSATILRQMLYSATRMG 128

  Fly    89 FYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERRNYTGVL 153
            .|......:..|......::..:..|::|||.|::.||||:||::||.:|..||...||||..|:
plant   129 IYDFLKRRWTDQLTGNFPLVTKITAGLIAGAVGSVVGNPADVAMVRMQADGSLPLNRRRNYKSVV 193

  Fly   154 NAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLK----AAFSEYFSGLSLHIAAAMMS 214
            :|..||.:.|||.:||:|...||.|||||...|||:|..:|    |.......|:..|:||:..:
plant   194 DAIDRIARQEGVSSLWRGSWLTVNRAMIVTASQLATYDHVKEILVAGGRGTPGGIGTHVAASFAA 258

  Fly   215 GLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFI 279
            |::..:||.|:|:.|||:.......|.|.:|..:|:...||..:|:||..|...|.||.|:..|:
plant   259 GIVAAVASNPIDVVKTRMMNADKEIYGGPLDCAVKMVAEEGPMALYKGLVPTATRQGPFTMILFL 323

  Fly   280 FLEQLTKAYKHI 291
            .|||:....|.:
plant   324 TLEQVRGLLKDV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 106/327 (32%)
Mito_carr 19..90 CDD:278578 31/123 (25%)
Mito_carr 104..201 CDD:278578 43/100 (43%)
Mito_carr 207..284 CDD:278578 28/76 (37%)
DIC3NP_196509.1 Mito_carr <19..139 CDD:395101 29/122 (24%)
Mito_carr 143..238 CDD:395101 42/94 (45%)
Mito_carr 251..336 CDD:395101 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2939
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2168
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.