DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and DIC2

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_194188.1 Gene:DIC2 / 828559 AraportID:AT4G24570 Length:313 Species:Arabidopsis thaliana


Alignment Length:307 Identity:119/307 - (38%)
Similarity:170/307 - (55%) Gaps:32/307 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GYMMYINGGLAGMLGTCIVQPLDLVKTRMQI-----SATTG------------------EYKSSF 53
            |...::.||:|.::..|...||||:|.|:|:     |.||.                  |..||.
plant     2 GVKSFVEGGIASVIAGCSTHPLDLIKVRLQLHGEAPSTTTVTLLRPALAFPNSSPAAFLETTSSV 66

  Fly    54 DCL------LKVFKNEGILALYNGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMG 112
            ..:      :.:.|:||..||::|:||.|:||..|:|.|||.|::..:.:....:....:...:|
plant    67 PKVGPISLGINIVKSEGAAALFSGVSATLLRQTLYSTTRMGLYEVLKNKWTDPESGKLNLSRKIG 131

  Fly   113 MGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVG 177
            .|::||..||..||||:||::||.:|.|||.|:||||.||.:|...:||.|||.:||:|...|:.
plant   132 AGLVAGGIGAAVGNPADVAMVRMQADGRLPLAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTIN 196

  Fly   178 RAMIVNMVQLASYSQLKAAFSE---YFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAE 239
            |||||...|||||.|.|....|   ...||..|:.|:..:|.:.::||.|:|:.|||:...|...
plant   197 RAMIVTAAQLASYDQFKEGILENGVMNDGLGTHVVASFAAGFVASVASNPVDVIKTRVMNMKVGA 261

  Fly   240 YKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTK 286
            |.|..|..:|..|.||..:|:|||.|.:||.||.||..|:.|||:.|
plant   262 YDGAWDCAVKTVKAEGAMALYKGFVPTVCRQGPFTVVLFVTLEQVRK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 118/303 (39%)
Mito_carr 19..90 CDD:278578 33/99 (33%)
Mito_carr 104..201 CDD:278578 48/99 (48%)
Mito_carr 207..284 CDD:278578 32/76 (42%)
DIC2NP_194188.1 Mito_carr 3..118 CDD:395101 34/114 (30%)
Mito_carr 122..220 CDD:395101 48/97 (49%)
Mito_carr 225..312 CDD:395101 36/84 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H117313
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D892773at2759
OrthoFinder 1 1.000 - - FOG0004406
OrthoInspector 1 1.000 - - otm2939
orthoMCL 1 0.900 - - OOG6_101430
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2168
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.