DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and AT4G03115

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001329297.1 Gene:AT4G03115 / 828074 AraportID:AT4G03115 Length:346 Species:Arabidopsis thaliana


Alignment Length:289 Identity:95/289 - (32%)
Similarity:144/289 - (49%) Gaps:25/289 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IPGYMMYIN----GGLAGMLGTCIVQPLDLVKTRMQIS--ATTGEYKSSFDCLLKVFKNEGILAL 68
            ||.:...::    .|::..|.|.:..|||:||.|:|:.  ...|.........|::.||||..:|
plant    60 IPPFSKVVSHFGISGISVALATGVTHPLDVVKVRLQMQHVGQRGPLIGMTGIFLQLMKNEGRRSL 124

  Fly    69 YNGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALI 133
            |.||:..|.|...|...|:|.|:....::...|.: ..||..:..|..||||.....||.||..:
plant   125 YLGLTPALTRSVLYGGLRLGLYEPTKVSFDWAFGS-TNVLVKIASGAFAGAFSTALTNPVEVVKV 188

  Fly   134 RM-MSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAF 197
            |: |:.|.:|.||.|          .||..||:..||||..|.:.||..:...|||:|.:.|...
plant   189 RLQMNPNAVPIAEVR----------EIVSKEGIGALWKGVGPAMVRAAALTASQLATYDEAKRIL 243

  Fly   198 SEYFS---GLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAE----YKGTMDVLMKVSKNEG 255
            .:..|   |..||:.:::::||::|:.:.|:||.|||:..|:.:|    |:.......||.:.||
plant   244 VKRTSLEEGFHLHLCSSVVAGLVSTLITAPMDMIKTRLMLQQGSESTKTYRNGFHCGYKVVRKEG 308

  Fly   256 IASLWKGFTPYLCRLGPHTVFAFIFLEQL 284
            ..:|:||......||||.|:..||..|:|
plant   309 PLALYKGGFAIFARLGPQTMITFILCEKL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 93/283 (33%)
Mito_carr 19..90 CDD:278578 25/72 (35%)
Mito_carr 104..201 CDD:278578 34/97 (35%)
Mito_carr 207..284 CDD:278578 28/80 (35%)
AT4G03115NP_001329297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.