DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and PUMP1

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_190979.1 Gene:PUMP1 / 824578 AraportID:AT3G54110 Length:306 Species:Arabidopsis thaliana


Alignment Length:290 Identity:92/290 - (31%)
Similarity:144/290 - (49%) Gaps:15/290 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AGMLGTCIVQPLDLVKTRMQI--SATTGE-----YKSSFDCLLKVFKNEGILALYNGLSAGLMRQ 79
            |..:|.....|||..|.|:|:  ||..|:     |:.....:..:.:.||:.:|:.|:..||.||
plant    21 AACVGEVCTIPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQ 85

  Fly    80 ATYTTARMGFYQMEIDAY-RKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPP 143
            ..:...|:|.|:...:.| .|.|.....:...:..|:..||.|.|..||.::..:|:.::.:|..
plant    86 CLFGGLRIGMYEPVKNLYVGKDFVGDVPLSKKILAGLTTGALGIMVANPTDLVKVRLQAEGKLAA 150

  Fly   144 AERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSE---YFSGLS 205
            ...|.|:|.|||:..||:.|||..||.|..|.|.|..|:|..:||||.|:|....:   :...:.
plant   151 GAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAELASYDQVKETILKIPGFTDNVV 215

  Fly   206 LHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRL 270
            .||.:.:.:|........|:|:.|:|:.....| ||||:|..:|..|::|..:.:|||.|...||
plant   216 THILSGLGAGFFAVCIGSPVDVVKSRMMGDSGA-YKGTIDCFVKTLKSDGPMAFYKGFIPNFGRL 279

  Fly   271 GPHTVFAFIFLEQLTKAYKHIVLGDDSESN 300
            |...|..|:.|||..|..:.:   |.|:.|
plant   280 GSWNVIMFLTLEQAKKYVREL---DASKRN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 88/275 (32%)
Mito_carr 19..90 CDD:278578 22/74 (30%)
Mito_carr 104..201 CDD:278578 34/99 (34%)
Mito_carr 207..284 CDD:278578 27/76 (36%)
PUMP1NP_190979.1 Mito_carr 7..106 CDD:395101 24/84 (29%)
Mito_carr 110..206 CDD:395101 34/95 (36%)
Mito_carr 210..299 CDD:395101 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.